spacer
spacer

SAS results for UniProt accession no. P00429

Sequence annotated by structure

Key:
Sec. struc: By homology Predicted
  Helix Strand   Helix Strand
Residue contacts:   to ligand   to metal
Active sites:   (from PDB SITE records)

Predicted secondary structure (green) comes from the DSC program. The lighter the green the less certain the prediction. Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P00429 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P00429 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 12 unique sequences (including 2 consensus sequences) giving 36 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00429 -----------------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*-----------------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*-----------------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A -----------------------------------------------------------------    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A -----------------------------------------------------------------    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A -----------------------------------------------------------------    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A -----------------------------------------------------------------    Structure of a functional unit from octopus hemocyanin
4byf:A drvgvqdfvllenftseaafienlrrrfrenliytyigpvlvsvnpyrdlqiysrqhmeryrgvs    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A -----------------------------------------------------------------    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A -----------------------------------------------------------------    The crystal structure of an abc transporter  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00429 -----------------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*-----------------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*-----------------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A -----------------------------------------------------------------    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A -----------------------------------------------------------------    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A -----------------------------------------------------------------    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A -----------------------------------------------------------------    Structure of a functional unit from octopus hemocyanin
4byf:A fyevpphlfavadtvyralrterrdqavmisgesgagkteatkrllqfyaetcpaperggavrdr    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A -----------------------------------------------------------------    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A -----------------------------------------------------------------    The crystal structure of an abc transporter  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00429 -----------------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*-----------------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*-----------------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A -----------------------------------------------------------------    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A -----------------------------------------------------------------    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A -----------------------------------------------------------------    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A -----------------------------------------------------------------    Structure of a functional unit from octopus hemocyanin
4byf:A llqsnpvleafgnaktlrndnssrfgkymdvqfdfkgapvgghilsylleksrvvhqnhgernfh    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A -----------------------------------------------------------------    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A -----------------------------------------------------------------    The crystal structure of an abc transporter  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00429 -----------------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*-----------------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*-----------------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A -----------------------------------------------------------------    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A -----------------------------------------------------------------    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A -----------------------------------------------------------------    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A -----------------------------------------------------------------    Structure of a functional unit from octopus hemocyanin
4byf:A ifyqlleggeeetlrrlglernpqsylylvkgqcakvssindksdwkvvrkaltvidftedeved    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A -----------------------------------------------------------------    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A -----------------------------------------------------------------    The crystal structure of an abc transporter  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00429 -----------------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*-----------------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*-----------------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A -----------------------------------------------------------------    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A -----------------------------------------------------------------    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A --------------------------------------------------------------ael    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A -----------------------------------------------------------------    Structure of a functional unit from octopus hemocyanin
4byf:A llsivasvlhlgnihfaanenaqvttenqlkyltrllsvegstlrealthrkiellsplnleqaa    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A -----------------------------------------------------------------    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A -----------------------------------------------------------------    The crystal structure of an abc transporter  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00429 -----------------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*-----------------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*-----------------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A -----------------------------------------------------------------    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A -----------------------------------------------------------------    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A acfcyphlendsykfipfnnlaikamltakvdkkdmdkfydsiiygiapppqfkkryntndnsrg    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A -----------------------------------------------------------------    Structure of a functional unit from octopus hemocyanin
4byf:A yardalakavysrtftwlvgkinrslaskdvespswrsttvlglldiygfevfqhnsfeqfciny    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A -----------------------------------------------------------------    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A -----------------------------------------------------------------    The crystal structure of an abc transporter  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00429 -----------------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*-----------------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*-----------------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A -----------------------------------------------------------------    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A -----------------------------------------------------------------    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A mnfetimftkvamlicealnslkvtqanvsnvlsrvvsirhlenlvirkenpqdilfhskdlllk    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A -----------------------------------------------------------------    Structure of a functional unit from octopus hemocyanin
4byf:A cneklqqlfieltlkseqeeyeaegiawepvqyfnnkiicdlveekfkgiisildeeclrpgeat    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A -----------------------------------------------------------------    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A -----------------------------------------------------------------    The crystal structure of an abc transporter  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00429 -----------------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*-----------------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*-----------------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A -----------------------------------------------------------------    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A -----------------------------------------------------------------    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A -----------------------------------------------------------------    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A stliaigqskeiettitaeggeivfqnaaftmwkltylehqlmpildqnfieykvtlnedkpisd    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A -----------------------------------------------------------------    Structure of a functional unit from octopus hemocyanin
4byf:A dltflekledtvkhhphflthkladrkslgrgefrllhyagevtysvtgfldknndllfrnlket    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A -------------------------ekrefdlsiedtrivlvgkrdfhtfafngqvpaplihvme    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A ------------------------------------------------naqitfvsqggayqaaq    The crystal structure of an abc transporter  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00429 -------------------------------------maediqakiknyqtapfdsrf--pnqnq    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*--------------------------------------------KIKNYQTAPFDSRF--PNQNQ×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*------------------------------------------------YQTAPFDSRF--PNQNQ×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A --aswqpsasipnllkraaimaeirrffadrgvlevetpcmsqatvtdihlvpfetrfvgpghsq    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A etaswqpsasipnllkraaimaeirrffadrgvlevetpcmsqatvtdihlvpfetrfvgpghsq    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A ----------------------------------------qetvvpsrvgdlkfesdf--ptqet    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A -----------------------------------------etvvpsrvgdlkfesdf--ptqet    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A vhvkelvaelrwqynkfavithgkgayrivkyssvanhadrvyatfksnvktgvnndf--nlldq    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A ---------aiirknvnsltpsdikelrdamakvqadtsdngyqkiasyhgiplschy--engta    Structure of a functional unit from octopus hemocyanin
4byf:A mcssknpimsqcfdrsekrpetvatqfkmsllqlveilqskepayvrcikpndakqpg--rfdev    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------gnvtlcegpnkfkchsgecitld--kvcnm    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A gddvtvnvtnmttlphtihwhgmlqrgtwqsdgvphatqhaiepgdtftykfkaepag--tmwyh    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A tvaildpsakklgitinqdsipdawpaiktqvgsgkpiwdvvdtptgyclrggeqgli--ekldf    The crystal structure of an abc transporter  ...

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00429 trnc--wqnyldf---hrc-----ekamtakggdv-svcewyrrvykslcpiswvstwddrraeg    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*TRNC--WQNYLDF---HRC-----EKAMTAKGGDV-SVCEWYRRVYKSLCPISWVSTWDDRRAEG×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*TRNC--WQNYLDF---HRC-----EKAMTAKGGDV-SVCEWYRRVYKSLCPISWVSTWDDRRAEG×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A gmnl--wlmtspe---yhm-----krllvagcgpvfqlcrsfrneemgryhnpeftmlewyrphy    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A gmnl--wlmtspe---yhm-----krllvagcgpvfqlcrsfrneemgryhnpeftmlewyrphy    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A mkn---mlnemdf---qra-----tqaylwgipas-simewlnvsrndfkfeegqmgffntlkqk    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A mkn---mlnemdf---qra-----tqaylwgipas-simewlnvsrndfkfeegqmgffntlkqk    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A -rii--wqnwyaf---tss-----mk----qgntl-dvck--rllfqkmkpfkglst--drkmde    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A yacc--qhgmvtfpnwhrlltkqmedalvakgshv-gipywdwtttfanlpvlvteekdnsfhha    Structure of a functional unit from octopus hemocyanin
4byf:A lirh--qvkylgl---len-----lrvrragfayr-rkyeaflqrykslcpetw-ptwagrpqdg    Crystal structure of human myosin 1c in complex with  ...
1xfe:A ardcrdwsde-pi---kecgt---necldnnggcs-hvcndlkigyeclcpdgfqlvaqrrce--    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A chvn--vnehvtm---rgm-----wgplivepknp-lpiektvtkdyilmlsdwvsswankpgeg    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A skip--naaampe---ayr-----spysvsyefys-svlaysqktfpkdapnswvdfwdvkk---    The crystal structure of an abc transporter  ...

                6         6         6         6         7         7     
                6         7         8         9         0         1     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00429 tfpgki-----------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*TFPGKI-----------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*TFPGKI-----------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A dmyrlmnevddllqqvldcpaaeslsyqqaflryleidplsadtllqllftfgvepnigkekptf    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A dmyrlmnevddllqqvldcpaaeslsyqqaflryleidplsadktqlrevaakldlsnvadteed    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A qgiitanfttpyvigtwnlektgpliinlpeakmagmmldvhqrvlsdlsllgpdkgkggkyliv    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A qgiitanfttpyvigtwnlektgpliinlpeakmagmmldvhqrvlsdlsllgpdkgkggkyliv    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A v----------------------------------------------------------------    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A hidvantdttrspraqlfsffyrqialaleqtdfcdfeiqfeighnaihswvggsspygmstlhy    Structure of a functional unit from octopus hemocyanin
4byf:A vavlvrhlgykpeeykmgrtkifirfpktlfatedalevrrqslatkiqaawrgfhwrqkfl---    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A gipgdvfdyytinaksfpetqpirvkkgdvirlrligagdhvhaihthghisqiafkdgfpldkp    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A -fpgrralrnhpiatleaalmadgvapdklypldvdrafkkleeikphitvwwtsgaqsaqllnd    The crystal structure of an abc transporter  ...

           7         7         7         7         7         7         7
           2         3         4         5         6         7         8
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00429 -----------------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*-----------------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*-----------------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A vyhfpasqaslaqistedhrvaerfevyykgielangfheltdareqqqrfeqdnrkraarglpq    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A rdtllqllftfgvepnigkekptfvyhfpasqaslaqistedhrvaerfevyykgielangfhel    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A ppgekykdlnpkgyyvirpktnvvyggirilepdvdrvvkqvvpnittqpyadgklgrkipvaqv    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A ppgekykdlnpkgyyvirpktnvvyggirilepdvdrvvkqvvpnittqpyadgklgrkipvaqv    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A -----------------------------------------------------------------    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A tsydplfylhhsntdriwsvwqalqkyrglpyntanceinklvkplkpfnldtnpnavtkahstg    Structure of a functional unit from octopus hemocyanin
4byf:A -----------------------------------------------------------------    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A ikgdtvligpgerydvilnmdnpglwmihdhvdthttngdkpdggimttieyeevgidhpfyvwk    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A gevdmemawngrvsavakegakvsftynqgilqstslcilkgapnletavkflneavdpvhqanl    The crystal structure of an abc transporter  ...

                7         8         8         8         8         8     
                9         0         1         2         3         4     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00429 -----------------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*-----------------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*-----------------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A hpidqnliealkvgmpdcsgvalgvdrlvmlalgaetlaeviafsvdra----------------    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A tdareqqqrfeqdnrkraarglpqhpidqnliealkvgmpdcsgvalgvdrlvmlalgaetlaev    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A peidwthipkdgleywktihqiiqenpveerdrfvmaqlkflgiekgkpfnpteeqkkilleask    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A peidwthipkdgleywktihqiiqenpveerdrfvmaqlkflgiekgkpfnpteeqkkilleask    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A -----------------------------------------------------------------    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A atsfdyhklgydydnlnfhgmtipeleehlkeiqhedrvfagfllrtigqsadvnfdvctkdgec    Structure of a functional unit from octopus hemocyanin
4byf:A -----------------------------------------------------------------    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A dkkfvpdfyyeeslkkdlgmhnskvfkgepi----------------------------------    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A plhidygpgnpkafetnvikperaaqlpsepanaakqalmsyawwsspageaaekrwasfmq---    The crystal structure of an abc transporter  ...

           8         8         8         8         8         9         9
           5         6         7         8         9         0         1
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00429 -----------------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*-----------------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*-----------------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A -----------------------------------------------------------------    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A iafsvdra---------------------------------------------------------    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A vgramaqsndytkrftqpywkgtnwkdaisvsldqrsenydelderaawfyeaitvsrgmkstip    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A vgramaqsndytkrftqpywkgtnwkdaisvsldqrsenydelderaawfyeaitvsrgmkstip    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A -----------------------------------------------------------------    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A tfggtfcilggehemfwafdrlfkydittslkhlrldahddfdikvtikgidghvlsnkylsppt    Structure of a functional unit from octopus hemocyanin
4byf:A -----------------------------------------------------------------    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A -----------------------------------------------------------------    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A -----------------------------------------------------------------    The crystal structure of an abc transporter  ...

                9         9         9         9         9         9     
                2         3         4         5         6         7     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00429 -----------------------------------------------------------------    Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*-----------------------------------------------------------------×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*-----------------------------------------------------------------×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A -----------------------------------------------------------------    Crystal structure of genx from escherichia coli in complex  ...
3a5z:A -----------------------------------------------------------------    Crystal structure of escherichia coli genx in complex with  ...
2p3y:A gfgqrylvtyqdsdgnwlsgehtyklhvpanvpasnfwsttvydennrlmiindagspdissrkn    Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A gfgqrylvtyqdsdgnwlsgehtyklhvpanvpasnfwsttvydennrlmiindagspdissrkn    Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A -----------------------------------------------------------------    Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A vflapa-----------------------------------------------------------    Structure of a functional unit from octopus hemocyanin
4byf:A -----------------------------------------------------------------    Crystal structure of human myosin 1c in complex with  ...
1xfe:A -----------------------------------------------------------------    Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A -----------------------------------------------------------------    Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A -----------------------------------------------------------------    The crystal structure of an abc transporter  ...

                               1         1         1         1     
           9         9         0         0         0         0     
           8         9         0         1         2         3     
       678901234567890123456789012345678901234567890123456789012345         Protein name
       ----+---------+---------+---------+---------+---------+-----         ------------
P00429 ------------------------------------------------------------         Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1  ...
1ocr:H*------------------------------------------------------------     ×18 Bovine heart cytochromE C oxidase in the fully reduced state
1occ:H*------------------------------------------------------------     ×8  Structure of bovine heart cytochromE C oxidase at the fully  ...
3a5y:A ------------------------------------------------------------         Crystal structure of genx from escherichia coli in complex  ...
3a5z:A ------------------------------------------------------------         Crystal structure of escherichia coli genx in complex with  ...
2p3y:A lkvnsdgsidvyygpkpvkgyennwvqtnpgegwftyfrfygptekmfdkswtmgdielv         Crystal structure of vpa0735 from vibrio parahaemolyticus.  ...
3vb9:A lkvnsdgsidvyygpkpvkgyennwvqtnpgegwftyfrfygptekmfdkswtmgdielv         Crystal structure of vpa0735 from vibrio parahaemolyticus  ...
2r7j:A ------------------------------------------------------------         Crystal structure of rotavirus non structural protein nsp2  ...
1js8:A ------------------------------------------------------------         Structure of a functional unit from octopus hemocyanin
4byf:A ------------------------------------------------------------         Crystal structure of human myosin 1c in complex with  ...
1xfe:A ------------------------------------------------------------         Solution structure of the la7-egfa pair from the ldl  ...
3g5w:A ------------------------------------------------------------         Crystal structure of blue copper oxidase from nitrosomonas e
4i1d:A ------------------------------------------------------------         The crystal structure of an abc transporter  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P00429. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 86 - - P00429 Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1 PE=1 SV=2
2. 586 100.0% 79 79 833.0 2e-39 1ocr:H * Bovine heart cytochromE C oxidase in the fully reduced state
3. " " " " " "  = 1v54:H *
Bovine heart cytochromE C oxidase at the fully oxidized stat
4. " " " " " "  = 1v55:H *
Bovine heart cytochromE C oxidase at the fully reduced state
5. " " " " " "  = 2dyr:H *
Bovine heart cytochromE C oxidase at the fully oxidized stat
6. " " " " " "  = 2dys:H *
Bovine heart cytochromE C oxidase modified by dccd
7. " " " " " "  = 2eij:H *
Bovine heart cytochromE C oxidase in the fully reduced state
8. " " " " " "  = 2eik:H *
Cadmium ion binding structure of bovine heart cytochromE C o the fully reduced state
9. " " " " " "  = 2eil:H *
Cadmium ion binding structure of bovine heart cytochromE C o the fully oxidized state
10. " " " " " "  = 2eim:H *
Zinc ion binding structure of bovine heart cytochromE C oxid fully reduced state
11. " " " " " "  = 2ein:H *
Zinc ion binding structure of bovine heart cytochromE C oxidase in the fully oxidized state
12. " " " " " "  = 2occ:H *
Bovine heart cytochromE C oxidase at the fully oxidized stat
13. " " " " " "  = 3abk:H *
Bovine heart cytochromE C oxidase at the no-bound fully redu (50k)
14. " " " " " "  = 3ag1:H *
Bovine heart cytochromE C oxidase in the carbon monoxide-bou reduced state at 280 k
15. " " " " " "  = 3ag2:H *
Bovine heart cytochromE C oxidase in the carbon monoxide-bou reduced state at 100 k
16. " " " " " "  = 3ag3:H *
Bovine heart cytochromE C oxidase in the nitric oxide-bound reduced state at 100 k
17. " " " " " "  = 3ag4:H *
Bovine heart cytochromE C oxidase in the cyanide ion-bound f reduced state at 100 k
18. " " " " " "  = 3asn:H *
Bovine heart cytochromE C oxidase in the fully oxidized stat at 1.7470 angstrom wavelength
19. " " " " " "  = 3aso:H *
Bovine heart cytochromE C oxidase in the fully oxidized stat at 0.9 angstrom wavelength
20. 562 100.0% 75 75 799.7 1.4e-37 1occ:H * Structure of bovine heart cytochromE C oxidase at the fully oxidized state
21. " " " " " "  = 1oco:H *
Bovine heart cytochromE C oxidase in carbon monoxide-bound state
22. " " " " " "  = 1ocz:H *
Bovine heart cytochromE C oxidase in azide-bound state
23. " " " " " "  = 2y69:H *
Bovine heart cytochromE C oxidase re-refined with molecular oxygen
24. " " " " " "  = 2ybb:S *
Fitted model for bovine mitochondrial supercomplex i1iii2iv single particle cryo-em (emd-1876)
25. " " " " " "  = 2zxw:H *
Bovine heart cytochromE C oxidase at the fully oxidized stat ray exposure dataset)
26. " " " " " "  = 3abl:H *
Bovine heart cytochromE C oxidase at the fully oxidized state (15-s x-ray exposure dataset)
27. " " " " " "  = 3abm:H *
Bovine heart cytochromE C oxidase at the fully oxidized state (200-s x-ray exposure dataset)
28. 86 26.8% 56 297 125.0 5.5 3a5y:A Crystal structure of genx from escherichia coli in complex w lysyladenylate analog
29. 86 26.8% 56 323 124.4 5.9 3a5z:A Crystal structure of escherichia coli genx in complex with e factor p
30. 80 35.0% 40 461 113.7 23 2p3y:A Crystal structure of vpa0735 from vibrio parahaemolyticus. N structural genomics target vpr109
31. 80 35.0% 40 460 113.7 23 3vb9:A Crystal structure of vpa0735 from vibrio parahaemolyticus in monoclinic form, northeast structural genomics target vpr10
32. 77 25.6% 78 307 112.2 29 2r7j:A Crystal structure of rotavirus non structural protein nsp2 with h225a mutation
33. 77 28.1% 57 382 110.7 34 1js8:A Structure of a functional unit from octopus hemocyanin
34. 79 46.2% 26 698 109.7 39 4byf:A Crystal structure of human myosin 1c in complex with calmodulin in the pre-power stroke state
35. 69 28.3% 46 83 109.4 41 1xfe:A Solution structure of the la7-egfa pair from the ldl receptor
36. 75 44.4% 18 318 109.1 42 3g5w:A Crystal structure of blue copper oxidase from nitrosomonas e
37. 75 32.4% 34 322 109.1 42 4i1d:A The crystal structure of an abc transporter substrate-bindin from bradyrhizobium japonicum usda 110

Number of sequences: 37

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer