
SAS results for UniProt accession no. P00423

Sequence annotated by structure

Sec. struc: By homology Predicted
  Helix Strand   Helix Strand
Residue contacts:   to ligand   to metal
Active sites:   (from PDB SITE records)

Predicted secondary structure (green) comes from the DSC program. The lighter the green the less certain the prediction. Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.


FASTA alignment for UniProt accession no. P00423 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P00423 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.



The search returned 20 unique sequences (including 6 consensus sequences) giving 54 sequence matches in all.

Modify alignment: Annotate by:
  Show secondary structure: Yes No  

                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00423 -----------------------------------------------------------------    Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C -----------------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
1qla:C*-----------------------------------------------------------------×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C -----------------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
2bs3:C -----------------------------------------------------------------    Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C -----------------------------------------------------------------    Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*------cnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvla×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A aplptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvla    Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A -----------------------------------------------------------------    Crystal structure of human septin trimer 2/6/7
2qa5:B -----------------------------------------------------------------    Crystal structure of sept2 g-domain
3osx:A -----------------------------------------------------------------    Crystal structure of apical domain of insecticidal groel  ...
3sv1:B -----------------------------------------------------------------    Crystal structure of app peptide bound rat mint2 parm
4a3a:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A -----------------------------------------------------------------    Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*-----------------------------------------------------------------×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
4cub:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
2vpw:A*----------------------------apwyaqevksvyqicegcfwrcgivahavgnrvykve×4  Polysulfide reductase with bound menaquinone

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00423 -----------------------------------------------------------------    Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C ---------------------------------------------------mtnesilesysgvt    Quinol:fumarate reductase from wolinella succinogenes
1qla:C*---------------------------------------------------mtnesilesysgvt×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C ---------------------------------------------------mtnesilesysgvt    Quinol:fumarate reductase from wolinella succinogenes
2bs3:C ---------------------------------------------------mtnesilesysgvt    Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C ---------------------------------------------------mtnesilesysgvt    Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*mdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervrav×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A mdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervrav    Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A -----anlpnqvhrksvkkgfeftlmvvgesglgkstlinslfltdltvqieastvegvklrltv    Crystal structure of human septin trimer 2/6/7
2qa5:B ---fanlpnqvhrksvkkgfeftlmvvgesglgkstlinslfltdltvqieastveigvklrltv    Crystal structure of sept2 g-domain
3osx:A -----------------------segmqfdrgylspyfinkpesgsvelenpyillvdkkisnir    Crystal structure of apical domain of insecticidal groel  ...
3sv1:B -----------------------------------------------------------------    Crystal structure of app peptide bound rat mint2 parm
4a3a:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A -----------------------------------------------------------------    Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*--------laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A -----qganisdqwtgselplafasdsnpsdpvsnvndklisynnqpanrwtnwnrsnpeasvgv    Unravelling the multiple functions of the architecturally  ...
4cub:A -----qganisdqwtgselplafasdsnpsdpvsnvndklisynnqpanrwtnwnrsnpeasvgv    Unravelling the multiple functions of the architecturally  ...
2vpw:A*gyeanpksrgrlcprgqgapqttydpdrlkrplirvegsqrgegkyrvatweealdhiakkmlei×4  Polysulfide reductase with bound menaquinone

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00423 -------------mlatrvfsligrraistsv-c----vrahgsvvksedyalpsyvd-rrdypl    Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*-------------------------------------------SVVKSEDYALPSYVD-RRDYPL×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C perkksrmpakldwwqsatglflglfmighmf-f----vstillgdnvmlwvtkkfql-dfifeg    Quinol:fumarate reductase from wolinella succinogenes
1qla:C*perkksrmpakldwwqsatglflglfmighmf-f----vstillgdnvmlwvtkkfel-dfifeg×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C perkksrmpakldwwqsatglflglfmighmf-f----vstillgdnvmlwvtkkfel-dfifeg    Quinol:fumarate reductase from wolinella succinogenes
2bs3:C perkksrmpakldwwqsatglflglfmighmf-f----vstillgdnvmlwvtkkfel-dfifeg    Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C perkksrmpakldwwqsatglflglfmighmf-f----vstillgdnvmlwvtkkfel-dfifeg    Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*aslntpfipanpnmsplesikanpvfdyqlyf-q----epgvaeaeleqnlsrtfksl-frasde×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A aslntpfipanpnmsplesikanpvfdyqlyf-q----epgvaeaeleqnlsrtfksl-frasde    Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*------------------gisrdsrhkrsatg-a----kraqfrkkrkfelgrqpant-kigakr×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A vdktiisyideqferylhdesglnrriidnrvhccfyfispfghglkpldvafmkaih-nvni-v    Crystal structure of human septin trimer 2/6/7
2qa5:B vdktiisyideqferylhdesglnrriidnrvhccfyfispfghglkpldvafmkaih-nvni-v    Crystal structure of sept2 g-domain
3osx:A ellpvlegvakaskplviiaedvegealatlv-v----nnmrg-ivkvasvkapgfgd-rrkaml    Crystal structure of apical domain of insecticidal groel  ...
3sv1:B ----------------------gsedlidgii-f----aanylgstqllsernpskni-rmmqaq    Crystal structure of app peptide bound rat mint2 parm
4a3a:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A -------------------------------------------------------------erfr    Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*dtnpakfrtlqnilevekemygaewpkvgatl-a----lmwlkrglrfiqvflqsicdgerdenh×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A lfgdsgilskrsvdnlsvgfhedhgvgapksy-v----ieyyvgktvptapknpsfvg-nedhvf    Unravelling the multiple functions of the architecturally  ...
4cub:A lfgdsgilskrsvdnlsvgfhedhgvgapksy-v----ieyyvgktvptapknpsfvg-nedhvf    Unravelling the multiple functions of the architecturally  ...
2vpw:A*rekygpeaiaffghgtgdywfvdflpaawgsp-n----aakpsvslctaprevasqwv-fgrpig×4  Polysulfide reductase with bound menaquinone

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00423 pdvahvknlsa-sqkalk-ekekaswssls-idekvelyrlk----fkes-f-ae-mnrstn---    Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*PDVAHVKNLSA-SQKALK-EKEKASWSSLS-IDEKVELYRLK----FKES-F-AE-MNRSTN---×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C gkpivvsflaa-fvfavf-iahaflamrkf-pinyrqyltfk----thkd-l-mr-hgdttl---    Quinol:fumarate reductase from wolinella succinogenes
1qla:C*gkpivvsflaa-fvfavf-iahaflamrkf-pinyrqyltfk----thkd-l-mr-hgdttl---×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C gkpivvsflaa-fvfavf-iahaflamrkf-pinyrqyltfk----thkd-l-mr-hgdttl---    Quinol:fumarate reductase from wolinella succinogenes
2bs3:C gkpivvsflaa-fvfavf-iahaflamrkf-pinyrqyltfk----thkd-l-mr-hgdttl---    Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C gkpivvsflaa-fvfavf-iahaflamrkf-pinyrqyltfk----thkd-l-mr-hgdttl---    Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*svlsmhkvcea-gglfvn-speepslsrmv-teeeiqfyvqq----fkksgfrgp-lnwyrnmer×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A svlsmhkvcea-gglfvn-speepslsrmv-teeeiqfyvqq----fkksgfrgp-lnwyrnmer    Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*ihsvrtrggnk-kyralrietgnfswaseg-iskktriagvv----yhps-n-ne-lvr-tn---×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A pviakadtlt------lk-ererlkkrildeieehikiyhlp----fkeq-t-rl-lkasip---    Crystal structure of human septin trimer 2/6/7
2qa5:B pviakadtlt------lk-ererlkkrildeieehikiyhlp----fkeq-t-rl-lkasip---    Crystal structure of sept2 g-domain
3osx:A qdiatltngtviseeigl-elekatledlg-qakrvvinkdt----ttii-d-gv-geegai---    Crystal structure of apical domain of insecticidal groel  ...
3sv1:B eavsrvkrm----qkaak-ikkkanqtlte-vdlfistqrik----v---------lnadtq---    Crystal structure of app peptide bound rat mint2 parm
4a3a:A ---------ra-qekvlq-klgkadetk----deqfeeyvqn----fkrq-e-ae-gtrlqr---    Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A ---------ra-qekvlq-klgkadetk----deqfeeyvqn----fkrq-e-ae-gtrlqr---    Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A tlkkklmvfte-yeqipk-kkangifstaa-lpenaersrirevvpyeen-r-ve-liptke---    Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*pnlirvnatka-yemalk-kyh--gwivqk-i-fqaalyaap----yksd-f-lkalsqnvt---×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A ndsanwkpvt--nlkapa-qlkagemnhfs-fd-kvetyair----irmv-k-ad-nkrgts---    Unravelling the multiple functions of the architecturally  ...
4cub:A ndsanwkpvt--nlkapa-qlkagemnhfs-fd-kvetyair----irmv-k-ad-nkrgts---    Unravelling the multiple functions of the architecturally  ...
2vpw:A*ghepidwenar-yivlig-hhigedthntq-lqdfalalkng----akvv-v-vd-prfsta---×4  Polysulfide reductase with bound menaquinone

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00423 ew-ktvvgaamffigfta----llliwekhy--v--ygpiphtfe--eew--vakqtkrmldmkv    Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*EW-KTVVGAAMFFIGFTA----LLLIWEKHY--V--YGPIPHTFE--EEW--VAKQTKRMLDMKV×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C wwiqamtgfamfflgsvh----lyimmtqpq--t--igpvsssfrmvsew--mwplylvllfave    Quinol:fumarate reductase from wolinella succinogenes
1qla:C*wwiqamtgfamfflgsvh----lyimmtqpq--t--igpvsssfrmvsew--mwplylvllfave×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C wwiqamtgfamfflgsvh----lyimmtqpq--t--igpvsssfrmvsew--mwplylvllfave    Quinol:fumarate reductase from wolinella succinogenes
2bs3:C wwiqamtgfamfflgsvh----lyimmtqpq--t--igpvsssfrmvsew--mwplylvllfavq    Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C wwiqamtgfamfflgsvh----lyimmtqpq--t--igpvsssfrmvsew--mwplylvllfavi    Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*nw-kwackslgrkilipa----lmvtaekdf--v--lvpqmsqhm--edw--iphlkrghiedcg×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A nw-kwackslgrkilipa----lmvtaekdf--v--lvpqmsqhm--edw--iphlkrghiedcg    Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*----tltkaaivqidatp----frqwfeahygqt--lgkksknae--rkw--aaraasakiessv×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A f---svvgsnqlivrgrl----ypwgvveve--n--phndflklr--tml--ithmqdlqevtqd    Crystal structure of human septin trimer 2/6/7
2qa5:B f---svvgsnqlivrgrl----ypwgvveve--n--phndflklr--tml--ithmqdlqevtqd    Crystal structure of sept2 g-domain
3osx:A aa-rvtqirqqieestsd----ydreklqer--v--aklaggvkl--n-----------------    Crystal structure of apical domain of insecticidal groel  ...
3sv1:B e---tmmdhalrtisyiadignivvlmarrk--q--ykmichvfe--sed--aqliaqsigqafs    Crystal structure of app peptide bound rat mint2 parm
4a3a:A el-rgyl-aaikgmqeas----mklteslhe--v--yep---------dw--ygredvkmvgekc    Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A el-rgyl-aaikgmqeas----mklteslhe--v--yep---------dw--ygredvkmvgekc    Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A nn-tgyinashikv--------vvggaewhy--iatqgplphtch--dfwqmvweqgvnviamvt    Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*ee-eclekirlflvnyta----tidviyemy--t--qmnaelnyk--v-----------------×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A it-evqifak-------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
4cub:A it-evqifakq------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
2vpw:A*aa-kahrwlpikpgtdta----lllawihvl--i--yedl---yd--key--vakytvgfeelk-×4  Polysulfide reductase with bound menaquinone

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00423 apiqgfsakwdydknewkk----------------------------------------------    Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*APIQGFSAKWDYDKNEWKK----------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtdpnidy    Quinol:fumarate reductase from wolinella succinogenes
1qla:C*lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtdpnidy×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtdpnidy    Quinol:fumarate reductase from wolinella succinogenes
2bs3:C lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtdpnidy    Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtdpnidy    Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*hwtqmdkptevnqilikwldsd-------------------------------------------×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A hwtqmdkptevnqilikwldsdarn----------------------------------------    Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*e--sqfsagrlyacissrpgqsgrcdgyilegeelafylrrltakk-------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A lhyenfrserl------------------------------------------------------    Crystal structure of human septin trimer 2/6/7
2qa5:B lhyenfrserl------------------------------------------------------    Crystal structure of sept2 g-domain
3osx:A -----------------------------------------------------------------    Crystal structure of apical domain of insecticidal groel  ...
3sv1:B vayqeflra--------------------------------------------------------    Crystal structure of app peptide bound rat mint2 parm
4a3a:A dvlwedfhqklvdgslltldtylgqfpdiknriakrsrklvdydsarhhlealqsskrkdesris    Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A dvlwedfhqklvdeslltldtylgqfpdiknriakrsrklvdydsarhhlealqsskrkdesris    Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A aeeeggrtk---shrywpkkhssatygkfkvttkfrtdsvcyattglkvkhllsgqertvwhlqy    Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*-----------------------------------------------------------------×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
4cub:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
2vpw:A*ahvkdftpewaekhteipaqvirevaremaahkpravlpptrhnvwygddtyrvmallyvnvllg×4  Polysulfide reductase with bound menaquinone

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00423 -----------------------------------------------------------------    Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C kyfdykrth--------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
1qla:C*kyfdykrth--------------------------------------------------------×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C kyfdykrthe-------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
2bs3:C kyfdykrthh-------------------------------------------------------    Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C kyfdykrthh-------------------------------------------------------    Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*-----------------------------------------------------------------×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A -----------------------------------------------------------------    Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A -----------------------------------------------------------------    Crystal structure of human septin trimer 2/6/7
2qa5:B -----------------------------------------------------------------    Crystal structure of sept2 g-domain
3osx:A -----------------------------------------------------------------    Crystal structure of apical domain of insecticidal groel  ...
3sv1:B -----------------------------------------------------------------    Crystal structure of app peptide bound rat mint2 parm
4a3a:A kaeeefqkaqkvfeefnvdlqeelpslwsrrvgfyvntfknvssleakfhkeiavlchklyevmt    Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A kaeeefqkaqkvfeefnvdlqeelpslwsrrvgfyvntfknvssleakfhkeiavlchklyevmt    Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A tdwpdhgcpedvqgflsyleeiqsvrrhtnsmlegtknrhppivvhcsagvgrtgvlilselmiy    Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*-----------------------------------------------------------------×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
4cub:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
2vpw:A*nygrpggfyiaqspylekyplpplplepaaggcsgpsggdhepegfkpradkgkffarstaiqel×4  Polysulfide reductase with bound menaquinone

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00423 -----------------------------------------------------------------    Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C -----------------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
1qla:C*-----------------------------------------------------------------×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C -----------------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
2bs3:C -----------------------------------------------------------------    Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C -----------------------------------------------------------------    Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*-----------------------------------------------------------------×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A -----------------------------------------------------------------    Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A -----------------------------------------------------------------    Crystal structure of human septin trimer 2/6/7
2qa5:B -----------------------------------------------------------------    Crystal structure of sept2 g-domain
3osx:A -----------------------------------------------------------------    Crystal structure of apical domain of insecticidal groel  ...
3sv1:B -----------------------------------------------------------------    Crystal structure of app peptide bound rat mint2 parm
4a3a:A klgdqha----------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A klgdqha----------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A clehnekvevpmmlrllreqrmfmiqtiaqykfvyqvliqflqns--------------------    Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*-----------------------------------------------------------------×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
4cub:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
2vpw:A*iepmitgepypikglfayginlfhsipnvprtkealknldlyvaidvlpqehvmwadvilpeaty×4  Polysulfide reductase with bound menaquinone

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00423 -----------------------------------------------------------------    Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C -----------------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
1qla:C*-----------------------------------------------------------------×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C -----------------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
2bs3:C -----------------------------------------------------------------    Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C -----------------------------------------------------------------    Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*-----------------------------------------------------------------×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A -----------------------------------------------------------------    Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A -----------------------------------------------------------------    Crystal structure of human septin trimer 2/6/7
2qa5:B -----------------------------------------------------------------    Crystal structure of sept2 g-domain
3osx:A -----------------------------------------------------------------    Crystal structure of apical domain of insecticidal groel  ...
3sv1:B -----------------------------------------------------------------    Crystal structure of app peptide bound rat mint2 parm
4a3a:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A -----------------------------------------------------------------    Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*-----------------------------------------------------------------×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
4cub:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
2vpw:A*leryddfvlvahktpfiqlrtpaheplfdtkpgwwiarelglrlgleqyfpwktieeyletrlqs×4  Polysulfide reductase with bound menaquinone

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00423 -----------------------------------------------------------------    Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C -----------------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
1qla:C*-----------------------------------------------------------------×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C -----------------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
2bs3:C -----------------------------------------------------------------    Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C -----------------------------------------------------------------    Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*-----------------------------------------------------------------×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A -----------------------------------------------------------------    Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A -----------------------------------------------------------------    Crystal structure of human septin trimer 2/6/7
2qa5:B -----------------------------------------------------------------    Crystal structure of sept2 g-domain
3osx:A -----------------------------------------------------------------    Crystal structure of apical domain of insecticidal groel  ...
3sv1:B -----------------------------------------------------------------    Crystal structure of app peptide bound rat mint2 parm
4a3a:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A -----------------------------------------------------------------    Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*-----------------------------------------------------------------×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
4cub:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
2vpw:A*lgldletmkgmgtlvqrgkpwledwekegrlpfgtasgkielycqrfkeaghqplpvftppeepp×4  Polysulfide reductase with bound menaquinone

                6         6         6         6         7         7     
                6         7         8         9         0         1     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00423 -----------------------------------------------------------------    Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C -----------------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
1qla:C*-----------------------------------------------------------------×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C -----------------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
2bs3:C -----------------------------------------------------------------    Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C -----------------------------------------------------------------    Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*-----------------------------------------------------------------×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A -----------------------------------------------------------------    Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A -----------------------------------------------------------------    Crystal structure of human septin trimer 2/6/7
2qa5:B -----------------------------------------------------------------    Crystal structure of sept2 g-domain
3osx:A -----------------------------------------------------------------    Crystal structure of apical domain of insecticidal groel  ...
3sv1:B -----------------------------------------------------------------    Crystal structure of app peptide bound rat mint2 parm
4a3a:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A -----------------------------------------------------------------    Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*-----------------------------------------------------------------×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
4cub:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
2vpw:A*egfyrllygrspvhtfartqnnwvlmemdpenevwihkeeakrlglkegdyvmlvnqdgvkegpv×4  Polysulfide reductase with bound menaquinone

           7         7         7         7         7         7         7
           2         3         4         5         6         7         8
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00423 -----------------------------------------------------------------    Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C -----------------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
1qla:C*-----------------------------------------------------------------×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C -----------------------------------------------------------------    Quinol:fumarate reductase from wolinella succinogenes
2bs3:C -----------------------------------------------------------------    Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C -----------------------------------------------------------------    Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*-----------------------------------------------------------------×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A -----------------------------------------------------------------    Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A -----------------------------------------------------------------    Crystal structure of human septin trimer 2/6/7
2qa5:B -----------------------------------------------------------------    Crystal structure of sept2 g-domain
3osx:A -----------------------------------------------------------------    Crystal structure of apical domain of insecticidal groel  ...
3sv1:B -----------------------------------------------------------------    Crystal structure of app peptide bound rat mint2 parm
4a3a:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A -----------------------------------------------------------------    Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A -----------------------------------------------------------------    Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*-----------------------------------------------------------------×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
4cub:A -----------------------------------------------------------------    Unravelling the multiple functions of the architecturally  ...
2vpw:A*rvkptarirkdcvyivhgfghkaplmrlahgrgasdnylqtrykldpisggaglrvnfvrlekae×4  Polysulfide reductase with bound menaquinone

       1234567890123456789                                                  Protein name
       ---------+---------                                                  ------------
P00423 -------------------                                                  Cytochrome c oxidase subunit 4 isoform 1, mitochondrial  ...
1occ:D*-------------------                                              ×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
1e7p:C -------------------                                                  Quinol:fumarate reductase from wolinella succinogenes
1qla:C*-------------------                                              ×2  Respiratory complex ii-like fumarate reductase from  ...
2bs2:C -------------------                                                  Quinol:fumarate reductase from wolinella succinogenes
2bs3:C -------------------                                                  Glu c180 -> gln variant quinol:fumarate reductase from  ...
2bs4:C -------------------                                                  Glu c180 -> ile variant quinol:fumarate reductase from  ...
3ans:A*-------------------                                              ×2  Human soluble epoxide hydrolase in complex with a synthetic
3pdc:A -------------------                                                  Crystal structure of hydrolase domain of human soluble  ...
3u5c:I*-------------------                                              ×4  The structure of the eukaryotic ribosome at 3.0 a  ...
2qag:A -------------------                                                  Crystal structure of human septin trimer 2/6/7
2qa5:B -------------------                                                  Crystal structure of sept2 g-domain
3osx:A -------------------                                                  Crystal structure of apical domain of insecticidal groel  ...
3sv1:B -------------------                                                  Crystal structure of app peptide bound rat mint2 parm
4a3a:A -------------------                                                  Crystal structure of the bar domain of human amphiphysin,  ...
4atm:A -------------------                                                  Crystal structure of the bar domain of human amphiphysin,  ...
2bzl:A -------------------                                                  Crystal structure of the human protein tyrosine phosphatase  ...
2euk:A*-------------------                                              ×2  Crystal structure of human glycolipid transfer protein  ...
4cua:A -------------------                                                  Unravelling the multiple functions of the architecturally  ...
4cub:A -------------------                                                  Unravelling the multiple functions of the architecturally  ...
2vpw:A*rprlpsltglakrpfderr                                              ×4  Polysulfide reductase with bound menaquinone

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P00423. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

z-score E-
Protein name
1. - - - 169 - - P00423 Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Bos taurus GN=COX4I1 PE=1 SV=1
2. 966 100.0% 144 144 1319.5 1.6e-66 1occ:D * Structure of bovine heart cytochromE C oxidase at the fully oxidized state
3. " " " " " "  = 1oco:D *
Bovine heart cytochromE C oxidase in carbon monoxide-bound state
4. " " " " " "  = 1ocr:D *
Bovine heart cytochromE C oxidase in the fully reduced state
5. " " " " " "  = 1ocz:D *
Bovine heart cytochromE C oxidase in azide-bound state
6. " " " " " "  = 1v54:D *
Bovine heart cytochromE C oxidase at the fully oxidized stat
7. " " " " " "  = 1v55:D *
Bovine heart cytochromE C oxidase at the fully reduced state
8. " " " " " "  = 2dyr:D *
Bovine heart cytochromE C oxidase at the fully oxidized stat
9. " " " " " "  = 2dys:D *
Bovine heart cytochromE C oxidase modified by dccd
10. " " " " " "  = 2eij:D *
Bovine heart cytochromE C oxidase in the fully reduced state
11. " " " " " "  = 2eik:D *
Cadmium ion binding structure of bovine heart cytochromE C o the fully reduced state
12. " " " " " "  = 2eil:D *
Cadmium ion binding structure of bovine heart cytochromE C o the fully oxidized state
13. " " " " " "  = 2eim:D *
Zinc ion binding structure of bovine heart cytochromE C oxid fully reduced state
14. " " " " " "  = 2ein:D *
Zinc ion binding structure of bovine heart cytochromE C oxidase in the fully oxidized state
15. " " " " " "  = 2occ:D *
Bovine heart cytochromE C oxidase at the fully oxidized stat
16. " " " " " "  = 2y69:D *
Bovine heart cytochromE C oxidase re-refined with molecular oxygen
17. " " " " " "  = 2ybb:O *
Fitted model for bovine mitochondrial supercomplex i1iii2iv single particle cryo-em (emd-1876)
18. " " " " " "  = 2zxw:D *
Bovine heart cytochromE C oxidase at the fully oxidized stat ray exposure dataset)
19. " " " " " "  = 3abk:D *
Bovine heart cytochromE C oxidase at the no-bound fully redu (50k)
20. " " " " " "  = 3abl:D *
Bovine heart cytochromE C oxidase at the fully oxidized state (15-s x-ray exposure dataset)
21. " " " " " "  = 3abm:D *
Bovine heart cytochromE C oxidase at the fully oxidized state (200-s x-ray exposure dataset)
22. " " " " " "  = 3ag1:D *
Bovine heart cytochromE C oxidase in the carbon monoxide-bou reduced state at 280 k
23. " " " " " "  = 3ag2:D *
Bovine heart cytochromE C oxidase in the carbon monoxide-bou reduced state at 100 k
24. " " " " " "  = 3ag3:D *
Bovine heart cytochromE C oxidase in the nitric oxide-bound reduced state at 100 k
25. " " " " " "  = 3ag4:D *
Bovine heart cytochromE C oxidase in the cyanide ion-bound f reduced state at 100 k
26. " " " " " "  = 3asn:D *
Bovine heart cytochromE C oxidase in the fully oxidized stat at 1.7470 angstrom wavelength
27. " " " " " "  = 3aso:D *
Bovine heart cytochromE C oxidase in the fully oxidized stat at 0.9 angstrom wavelength
28. 88 25.9% 58 254 122.2 7.8 1e7p:C Quinol:fumarate reductase from wolinella succinogenes
29. 88 25.9% 58 254 122.2 7.8 1qla:C * Respiratory complex ii-like fumarate reductase from wolinella succinogenes
30. " " " " " "  = 1qlb:C *
Respiratory complex ii-like fumarate reductase from wolinella succinogenes
31. 88 25.9% 58 255 122.2 7.9 2bs2:C Quinol:fumarate reductase from wolinella succinogenes
32. 88 25.9% 58 255 122.2 7.9 2bs3:C Glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes
33. 88 25.9% 58 255 122.2 7.9 2bs4:C Glu c180 -> ile variant quinol:fumarate reductase from wolinella succinogenes
34. 87 28.2% 78 314 119.3 11 3ans:A * Human soluble epoxide hydrolase in complex with a synthetic
35. " " " " " "  = 3ant:A *
Human soluble epoxide hydrolase in complex with a synthetic
36. 87 28.2% 78 323 119.1 12 3pdc:A Crystal structure of hydrolase domain of human soluble epoxi hydrolase complexed with a benzoxazole inhibitor
37. 84 28.4% 102 188 118.9 12 3u5c:I * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 40s subunit, ribosome a
38. " " " " " "  = 3u5g:I *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 40s subunit, ribosome b
39. " " " " " "  = 4byl:I *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
40. " " " " " "  = 4byt:I *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
41. 82 26.4% 110 232 114.7 21 2qag:A Crystal structure of human septin trimer 2/6/7
42. 82 26.4% 110 234 114.6 21 2qa5:B Crystal structure of sept2 g-domain
43. 79 31.3% 67 190 112.0 29 3osx:A Crystal structure of apical domain of insecticidal groel fro xenorhapdus nematophila
44. 76 28.3% 92 143 110.0 38 3sv1:B Crystal structure of app peptide bound rat mint2 parm
45. 78 26.9% 93 221 109.6 40 4a3a:A Crystal structure of the bar domain of human amphiphysin, isoform 1 at 1.8 angstrom resolution featuring increased order at the n-terminus.
46. 78 26.9% 93 221 109.6 40 4atm:A Crystal structure of the bar domain of human amphiphysin, isoform 1 at 1.8 angstrom resolution featuring increased order at the n-terminus.
47. 79 22.6% 115 284 109.2 42 2bzl:A Crystal structure of the human protein tyrosine phosphatase n14 at 1.65 a resolution
48. 77 23.9% 92 204 108.8 44 2euk:A * Crystal structure of human glycolipid transfer protein complexed with 24:1 galactosylceramide
49. " " " " " "  = 2evd:A *
Crystal structure of human glycolipid transfer protein compl 12:0 lactosylceramide
50. 76 28.6% 63 178 108.4 46 4cua:A Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa
51. 76 28.6% 63 179 108.4 46 4cub:A Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa
52. 83 32.1% 53 735 107.9 49 2vpw:A * Polysulfide reductase with bound menaquinone
53. " " " " " "  = 2vpx:A *
Polysulfide reductase with bound quinone (uq1)
54. " " " " " "  = 2vpy:A *
Polysulfide reductase with bound quinone inhibitor, pentachlorophenol (pcp)
55. " " " " " "  = 2vpz:A *
Polysulfide reductase native structure

Number of sequences: 55

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

