spacer
spacer

SAS results for UniProt accession no. P00415

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand   to metal
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P00415 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P00415 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 28 unique sequences (including 4 consensus sequences) giving 53 sequence matches in all. The 9 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A WAVLWDLLTTVDHKKIGLMYTATAFFAFALAGVFSLLIRTQLAVPNNQFLTGEQYNQILTLHGAT    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A -----------------------------------------------------------------    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A MLFFFIIQAGLTGFGNFVVPLMLGARDVALPRVNAFSYWAFLGAIVLALMSYFFPGGAPSVGWTF    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A -----------------------------------------------------------------    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A YYPFSAQSESGVDFYLAAILLLGFSSLLGNANFVATIYNLRAQGMSLWKMPIYVWSVFAASVLNL    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A -----------------------------------------------------------------    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A FSLAGLTAATLLVLLERKIGLSWFNPAVGGDPVLFQQFFWFYSHPTVYVMLLPYLGILAEVASTF    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A -----------------------------------------------------------------    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A ARKPLFGYRQMVWAQMGIVVLGTMVWAHHMFTVGESTLFQIAFAFFTALIAVPTGVKLFNIIGTL    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A -----------------------------------------------------------------    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A WGGKLQMKTPLYWVLGFIFNFLLGGITGVMLSMTPLDYQFHDSYFVVAHFHNVLMAGSGFGAFAG    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A -----------------------------------------------------------------    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A LYYWWPKMTGRMYDERLGRLHFWLFLVGYLLTFLPQYALGYLGMPRRYYTYNADIAGWPELNLLS    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A -----------------------------------------------------------------    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A -----------------------------------------------------msyqyvnvvtin    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A ------------------------------------------------msyqyvnvvtinkvavi    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A TIGAYILGLGGLVWIYTMWKSLRSGPKAPDNPWGGYTLEWLTASPPKAHNFDVKLPTEFPSERPL    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A -----------------------------------------------------------------    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A kvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgskvfsaghdiheldplsyd    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A efnygrklnalskvfiddlmqalsdlnrpeirciilrapsgskvfsaghdihelpsggrdplsyd    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00415 ----------mthqthayhmvnpspwpltgals--------allmtsgltmwfh---fn--smt-    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N ----------mthqthayhmvnpspwpltgals--------allmtsgltmwfh---fn--smt-    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*----------mthqthayhmvnpspwpltgals--------allmtsgltmwfh---fn--smt-×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*------------HQTHAYHMVNPSPWPLTGALS--------ALLMTSGLTMWFH---FN--SMT-×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A ----------mahqahsyhmvdpspwpifgaaa--------allttsglimwfh---ys--stt-    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*----------AHAKNHDYHILPPSIWPFMASVG--------AFVMLFGAVLWMH---GS--GPW-×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C ----------AHVKNHDYQILPPSIWPFFGAIG--------AFVMLTGAVAWMKGITFF--GLPV    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A YDWKKKGVELKPEDPAHIHLPNSSFWPFYSAATLFAFFVAVAALPVPNVWMWVF--------LA-    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A ----------------------------------------------------------m--vml-    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H ---------------qvqlqqsdaelvkpgasv--------kisckasgytftd---ha--ihw-    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A ----------------------------------------------aefrvrvs---tg--eaf-    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A dplrqitrmiqkfpkpiismvegsvw---ggaf--------emimssdliiaas---tstfsmt-    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A dplrqitrmiqkfpkpiismvegsvw---ggaf--------emimssdliiaas---tstfsmt-    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C ------------------------------------------------nhtflh---tv--ycq-    Crystal structure of hla-dm bound to hla-dr1

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00415 ----llmiglttnmltmyqwwrd----virestfqghhtpavqkg--lrygmilfiise---vlf    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N ----llmiglttnmltmyqwwrd----virestfqghhtpavqkg--lrygmilfiise---vlf    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*----llmiglttnmltmyqwwrd----virestfqghhtpavqkg--lrygmilfiise---vlf×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*----LLMIGLTTNMLTMYQWWRD----VIRESTFQGHHTPAVQKG--LRYGMILFIISE---VLF×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A ----lltmgllsmllvmlqwwrd----vvrestfqghhtptvqkg--lrygmilfitse---aff    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*----MGLIGLVVVLYTMFGWWSD----VVTES-LEGDHTPVVRLG--LRWGFILFIMSE---VMF×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C EGPWMFLIGLVGVLYVMFGWWAD----VVNEGE-TGEHTPVVRIG--LQYGFILFIMSE---VMF    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A ----LFAYGLVR--------WAL----EDEYSHPVEHHTVTGKSN--AWMGMAWFIVSE---VGL    Structure of caa3-type cytochrome oxidase
1fft:C ---------------------------------------hdaggt--kifgfwiylmsd---cil    The structure of ubiquinol oxidase from escherichia coli
4gf0:B ----------------------l----tlyftpgtisvavaiaie--eaalpyqpvrvr---vpa    Crystal structure of glutahtione transferase homolog from  ...
  " :A ----tlyftpgtisvavaiaiee----aalpyqpvrvdfataeqt--kpdylainpkgr---vpa    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------kkpaah----ligdpskqnsllwrantd--raflqdgfslsn---nsl    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A --------------kpaahligd----pskqnsllwrantdrafl--qdgfslsnnsll---vpt    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -------kpaahligdpskqnsl----lwrantdraflqdgfsls--nnsllvptsgiy---fvy    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H ----vkqkpglewigyispgngd----ikynekfkgkatltadkssstaymqlnsltsedsavyf    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A ----gagtwdkvsvsivgtrges----pplpldnlgkeftagaee--dfqvtlpedvgr---vll    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A ----pvnlgvpynlvgihnltrdagfhivkeliftaspita-qra--lavgilnhvv-e---vee    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A ----pvnlgvpynlvgihnltrdagfhivkeliftaspita-qra--lavgilnhvv-e---vee    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C ----dgspsvglseaydedqlff----fdfsqntrvprlpefadw--aqeqgdapailf---dke    Crystal structure of hla-dm bound to hla-dr1

                6         6         6         6         7         7     
                6         7         8         9         0         1     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00415 ftgffwafyh--sslap----tpelggc-w----pptgihplnplevp--l--lntsvl--lasg    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N ftgffwafyh--sslap----tpelggc-w----pptgihplnplevp--l--lntsvl--lasg    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*ftgffwafyh--sslap----tpelggc-w----pptgihplnplevp--l--lntsvl--lasg×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*FTGFFWAFYH--SSLAP----TPELGGC-W----PPTGIHPLNPLEVP--L--LNTSVL--LASG×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A flgffwaffh--sslap----tpelggq-w----pptgvkplnplevp--l--lntail--lasg    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*FSAWFWSFFK--HALYPMGPESPIIDGI-F----PPEGIITFDPWHLP--L--INTLIL--LCSG×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C FVAWFWAFIK--NALYPMGPDSPIKDGV-W----PPEGIVTFDPWHLP--L--INTLIL--LLSG    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A FAILIAGYLY--LRLS---------GAA-T----PPEE-RP--ALWLA--L--LNTFLL--VSSS    Structure of caa3-type cytochrome oxidase
1fft:C fsilf-atya--vlvng----ta--gg--------ptgk---difelpfvl--vetfll--lfss    The structure of ubiquinol oxidase from escherichia coli
4gf0:B lrleddtilt--etgal----ldyvaai-a----pkaglvptdptaaa--q--mrsamyy-last    Crystal structure of glutahtione transferase homolog from  ...
  " :A lrleddtilt--etgal----ldyvaai-a----pkaglvptdptaaa--q--mrsamyy-last    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X lvptsgiyfv--ysqvv----fsplyla-h----evqlfssqypfhvp--l--lssqkm--vypg    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A sgiyfvysqv--vfsgk----ssplyla-h----evqlfssqypfhvp--l--lssqkm--vypg    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A sqvvfsgkay--spkat----ssplyla-h----evqlfssqypfhvp--l--lssqkm--vypg    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H ckmeyldywg--qgttl----tvssggt-t----pps-vyplapgsaa--q--tnsvtlgclvkg    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A lrvhkappvl--pllgpl---apdawfcrwfqltpprgghllfpcyqw--legagtlvl--qegt    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A --------gs--hmtkp----apdfggr-w----khvnhfdeapteip--l--ytsyty--qatp    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A ledftlqmahhisekap----laiavik-e----elrvlgeahtmnsd--e--feriqg--mrra    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A ledftlqmahhisekap----laiavik-e----elrvlgeahtmnsd--e--feriqg--mrra    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C fcewmiqqig--pkldg----kipvsrg-f----piaevftlkplefg--k--pntlvc--fvsn    Crystal structure of hla-dm bound to hla-dr1

           7         7         7         7         7         7         7
           2         3         4         5         6         7         8
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00415 -----v-----sit-------wa-hhsl-m-egdrkh--mlqa-lfititlgvyftllqaseyye    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----v-----sit-------wa-hhsl-m-egdrkh--mlqa-lfititlgvyftllqaseyye    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----v-----sit-------wa-hhsl-m-egdrkh--mlqa-lfititlgvyftllqaseyye×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----V-----SIT-------WA-HHSL-M-EGDRKH--MLQA-LFITITLGVYFTLLQASEYYE×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----v-----tvt-------wa-hhsi-t-egnrkq--aiha-ltltillgfyftalqameyhe    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----C-----AAT-------WA-HHAL-VHENNRRD--VAWG-LALAIALGALFTVFQAYEYSH×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----V-----AVT-------WA-HHAFVL-EGDRKT--TING-LIVAVILGVCFTGLQAYEYSH    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A -----F-----TVH-------FA-HHDL-R-RGRFNP--FRFG-LLVTIILGVLFFLVQSWEFYQ    Structure of caa3-type cytochrome oxidase
1fft:C -----i-----tyg-------ma-aiam-y-knnksq--visw-laltwlfgagfigm---eiye    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----m-----hva-------ha-hk---m-rgsrwa--kqqs-sfedmtaqvpetmaacadfve    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----m-----hva-------ha-hk---m-rgsrwa--kqqs-sfedmtaqvpetmaacadfve    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----l-----qep-------wl-h-sm-y-hgaafq--ltqgdqlsthtdgiphlvlspstvff    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----l-----qep-------wl-h-sm-y-hgaafq--ltqgdqlsthtdgiphlvlspstvff    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----l-----qep-------wl-h-sm-y-hgaafq--ltqgdqlsthtdgiphlvlspstvff    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H yfpepv-----tvt-------wn-sgsl-s-sgvhtfpavlqs-dlytlsssvtvpsstwpsqsv    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A -----a-----kvs-------wadhhpv-l-qqqrqe--elqa-rqemyqwkaynpgwphcldek    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----m-----dgtlktmlerwa-adsn-m-qlsynl--psdy-tligpvsaisttsvqqaatel    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------kh--plkt-fylaitagvfisi--afvfy-    Structure of formate channel
1ef8:A -----v-----yds-------ed-yqeg-m-naflek--rkpn-fvgh-----------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----v-----yds-------ed-yqeg-m-naflek--rkpn-fvgh-----------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----lfppmltvn-------wq-hhsvpv-eg-------fgp-tfvsavdglsfqafsyldftp    Crystal structure of hla-dm bound to hla-dr1

                7         8         8         8         8         8     
                9         0         1         2         3         4     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00415 apftis--dgv------ygstffvatgfhglhviigstflivc---ffrqlkfhftsnhh----f    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N apftis--dgv------ygstffvatgfhglhviigstflivc---ffrqlkfhftsnhh----f    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*apftis--dgv------ygstffvatgfhglhviigstflivc---ffrqlkfhftsnhh----f×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*APFTIS--DGV------YGSTFFVATGFHGLHVIIGSTFLIVC---FFRQLKFHFTSNHH----F×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A asfsia--dsv------ygstffvatgfhglhviigssfltvc---llrlikfhftpnhh----f    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*AAFGFA--GNI------YGANFFMATGFHGFHVIVGTIFLLVC---LIRVQRGHFTPEKH----V×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C AAFGLA--DTV------YAGAFYMATGFHGAHVIIGTIFLFVC---LIRLLKGQMTQKQH----V    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A FYHHSSWQENL------WTAAFFTIVGLHGLHVVIGGFGLILA---YLQALRGKITLHNH----G    Structure of caa3-type cytochrome oxidase
1fft:C fhhliv--ngmgpdrsgflsaffalvgthglhvtsgliwmavl---mvqiarrgltstnr----t    The structure of ubiquinol oxidase from escherichia coli
4gf0:B sdilrg--pyv------lgedfsladpylfvvcnwldgdgvdt---aaypkittfmqqmt----a    Crystal structure of glutahtione transferase homolog from  ...
  " :A sdilrg--pyv------lgedfsladpylfvvcnwldgdgvdt---aaypkittfmqqmt----a    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X gafal------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A gafal------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A gafal------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H tcnvah--pas------stavdkkiapa-------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A tvedle--lni------kystaknanfylqagsafaemkikgl---ldrkglwrslnemk----r    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A savyaa--qgv------svsvsankllvqpvpvssgakl--------------------------    Nmr structure of the xanthomonas virb7
3kcu:A --itat--tgt------gtmpfgmaklvggicfslglilcvvcgadlftstvlivvakasgritw    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C epsdif--sci------vtheidrytaiaywvprnalpsl-------------------------    Crystal structure of hla-dm bound to hla-dr1

           8         8         8         8         8         9         9
           5         6         7         8         9         0         1
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00415 gfeaaawy-whfvdvvwlflyvsiywwgs------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N gfeaaawy-whfvdvvwlflyvsiywwgs------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*gfeagawy-whfvdvvwlflyvsiywwgs------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*GFEAAAWY-WHFVDVVWLFLYVSIYWWGS------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A gfeaaawy-whfvdiiwlflymsmywwgs------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*GFEAAIWY-WHFVDVVWLFLFASIYIWGQ------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C GFEAAAWY-WHFVDVVWLFLFVVIYIWGR------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A TLEAASMY-WHLVDAVWLVIVTIFYVW--------------------------------------    Structure of caa3-type cytochrome oxidase
1fft:C rimclslf-whfldvvwicvftvvylmga------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B rasvaavk-dkgml---------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A rasvaavk-dkgml---------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A ifnfrrtp-aaehafehwqedaffasqflnglnpvlirrchylpknfpvtdamvasvlgpgtslq    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A gqlaknwlnvyfgnlvgallfvllmwlsgeymtangqwglnvlqtadhkvhhtfieavclgilan    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

                9         9         9         9         9         9     
                2         3         4         5         6         7     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A -----------------------------------------------------------------    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A aelekgslflvdhgilsgiqtnvingkpqfsaapmtllyqspgcgpllplaiqlsqtpgpnspif    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A lmvclavwmsysgrslmdkafimvlpvamfvasgfehsianmfmipmgivirdfaspefwtavgs    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

                               1         1         1         1         1
           9         9         0         0         0         0         0
           8         9         0         1         2         3         4
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A -----------------------------------------------------------------    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A lptddkwdwllaktwvrnaefsfhealthllhshllpevftlatlrqlphchplfklliphtryt    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A apenfshltvmnfitdnlipvtigniigggllvgltywviylr----------------------    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

                1         1         1         1         1         1     
                0         0         0         0         0         1     
                5         6         7         8         9         0     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A -----------------------------------------------------------------    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A lhintlarellivpgqvvdrstgigiegfseliqrnmkqlnysllclpedirtrgvedipgyyyr    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

           1         1         1         1         1         1         1
           1         1         1         1         1         1         1
           1         2         3         4         5         6         7
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A -----------------------------------------------------------------    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A ddgmqiwgaverfvseiigiyypsdesvqddrelqawvreifskgflnqessgipssletrealv    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

                1         1         1         1         1         1     
                1         1         2         2         2         2     
                8         9         0         1         2         3     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A -----------------------------------------------------------------    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A qyvtmviftcsakhaavsagqfdscawmpnlppsmqlppptskglatcegfiatlppvnatcdvi    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

           1         1         1         1         1         1         1
           2         2         2         2         2         2         3
           4         5         6         7         8         9         0
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00415 -----------------------------------------------------------------    Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -----------------------------------------------------------------    Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-----------------------------------------------------------------×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-----------------------------------------------------------------×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -----------------------------------------------------------------    Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -----------------------------------------------------------------    Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A -----------------------------------------------------------------    Structure of caa3-type cytochrome oxidase
1fft:C -----------------------------------------------------------------    The structure of ubiquinol oxidase from escherichia coli
4gf0:B -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
  " :A -----------------------------------------------------------------    Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -----------------------------------------------------------------    Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -----------------------------------------------------------------    Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -----------------------------------------------------------------    Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -----------------------------------------------------------------    Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A lalwllskepgdqrplgtypdehfteeaprrsiatfqsrlaqisrgiqernqglvlpytyldppl    The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -----------------------------------------------------------------    Nmr structure of the xanthomonas virb7
3kcu:A -----------------------------------------------------------------    Structure of formate channel
1ef8:A -----------------------------------------------------------------    Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -----------------------------------------------------------------    The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -----------------------------------------------------------------    Crystal structure of hla-dm bound to hla-dr1

              
              
              
       1234567                                                              Protein name
       -------                                                              ------------
P00415 -------                                                              Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1  ...
2ybb:N -------                                                              Fitted model for bovine  mitochondrial supercomplex  ...
1occ:C*-------                                                          ×5  Structure of bovine heart cytochromE C oxidase at the fully  ...
1v54:C*-------                                                          ×20 Bovine heart cytochromE C oxidase at the fully oxidized stat
1llk:A -------                                                              Structure of cytochromE C oxidase polypeptide iii-gallus  ...
1m56:C*-------                                                          ×2  Structure of cytochromE C oxidase from rhodobactor  ...
1qle:C -------                                                              Cryo-structure of the paracoccus denitrificans four-subunit  ...
2yev:A -------                                                              Structure of caa3-type cytochrome oxidase
1fft:C -------                                                              The structure of ubiquinol oxidase from escherichia coli
4gf0:B -------                                                              Crystal structure of glutahtione transferase homolog from  ...
  " :A -------                                                              Crystal structure of glutahtione transferase homolog from  ...
4mxw:X -------                                                              Structure of heterotrimeric lymphotoxin lta1b2 bound to  ...
4mxv:A -------                                                              Structure of lymphotoxin alpha bound to anti-lta fab
1tnr:A -------                                                              Crystal structure of the soluble human 55 kd tnf receptor-  ...
1mex:H -------                                                              Antibody catalysis of a bimolecular cycloaddition reaction
4nre:A iensvsi                                                              The structure of human 15-lipoxygenase-2 with a substrate mi
2l4w:A -------                                                              Nmr structure of the xanthomonas virb7
3kcu:A -------                                                              Structure of formate channel
1ef8:A -------                                                              Crystal structure of methylmalonyl coa decarboxylase
1ef9:A -------                                                              The crystal structure of methylmalonyl coa decarboxylase  ...
4fqx:C -------                                                              Crystal structure of hla-dm bound to hla-dr1

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P00415. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 261 - - P00415 Cytochrome c oxidase subunit 3 OS=Bos taurus GN=MT-CO3 PE=1 SV=2
2. 1832 100.0% 261 261 2514.9 4.2e-133 2ybb:N Fitted model for bovine mitochondrial supercomplex i1iii2iv single particle cryo-em (emd-1876)
3. 1827 99.6% 261 261 2508.1 1e-132 1occ:C * Structure of bovine heart cytochromE C oxidase at the fully oxidized state
4. " " " " " "  = 1oco:C *
Bovine heart cytochromE C oxidase in carbon monoxide-bound state
5. " " " " " "  = 1ocr:C *
Bovine heart cytochromE C oxidase in the fully reduced state
6. " " " " " "  = 1ocz:C *
Bovine heart cytochromE C oxidase in azide-bound state
7. " " " " " "  = 2occ:C *
Bovine heart cytochromE C oxidase at the fully oxidized stat
8. 1820 100.0% 259 259 2498.5 3.4e-132 1v54:C * Bovine heart cytochromE C oxidase at the fully oxidized stat
9. " " " " " "  = 1v55:C *
Bovine heart cytochromE C oxidase at the fully reduced state
10. " " " " " "  = 2dyr:C *
Bovine heart cytochromE C oxidase at the fully oxidized stat
11. " " " " " "  = 2dys:C *
Bovine heart cytochromE C oxidase modified by dccd
12. " " " " " "  = 2eij:C *
Bovine heart cytochromE C oxidase in the fully reduced state
13. " " " " " "  = 2eik:C *
Cadmium ion binding structure of bovine heart cytochromE C o the fully reduced state
14. " " " " " "  = 2eil:C *
Cadmium ion binding structure of bovine heart cytochromE C o the fully oxidized state
15. " " " " " "  = 2eim:C *
Zinc ion binding structure of bovine heart cytochromE C oxid fully reduced state
16. " " " " " "  = 2ein:C *
Zinc ion binding structure of bovine heart cytochromE C oxidase in the fully oxidized state
17. " " " " " "  = 2y69:C *
Bovine heart cytochromE C oxidase re-refined with molecular oxygen
18. " " " " " "  = 2zxw:C *
Bovine heart cytochromE C oxidase at the fully oxidized stat ray exposure dataset)
19. " " " " " "  = 3abk:C *
Bovine heart cytochromE C oxidase at the no-bound fully redu (50k)
20. " " " " " "  = 3abl:C *
Bovine heart cytochromE C oxidase at the fully oxidized state (15-s x-ray exposure dataset)
21. " " " " " "  = 3abm:C *
Bovine heart cytochromE C oxidase at the fully oxidized state (200-s x-ray exposure dataset)
22. " " " " " "  = 3ag1:C *
Bovine heart cytochromE C oxidase in the carbon monoxide-bou reduced state at 280 k
23. " " " " " "  = 3ag2:C *
Bovine heart cytochromE C oxidase in the carbon monoxide-bou reduced state at 100 k
24. " " " " " "  = 3ag3:C *
Bovine heart cytochromE C oxidase in the nitric oxide-bound reduced state at 100 k
25. " " " " " "  = 3ag4:C *
Bovine heart cytochromE C oxidase in the cyanide ion-bound f reduced state at 100 k
26. " " " " " "  = 3asn:C *
Bovine heart cytochromE C oxidase in the fully oxidized stat at 1.7470 angstrom wavelength
27. " " " " " "  = 3aso:C *
Bovine heart cytochromE C oxidase in the fully oxidized stat at 0.9 angstrom wavelength
28. 1482 75.5% 261 261 2034.6 2.4e-106 1llk:A Structure of cytochromE C oxidase polypeptide iii-gallus gallus
29. 938 48.5% 262 265 1288.0 9.2e-65 1m56:C * Structure of cytochromE C oxidase from rhodobactor sphaeroides (wild type)
30. " " " " " "  = 1m57:C *
Structure of cytochromE C oxidase from rhodobacter sphaeroides (eq(i-286) mutant))
31. 933 49.6% 270 273 1183.4 6.1e-59 1qle:C Cryo-structure of the paracoccus denitrificans four-subunit cytochromE C oxidase in the completely oxidized state complexed with an antibody fv fragment
32. 382 31.8% 261 780 500.3 6.8e-21 2yev:A Structure of caa3-type cytochrome oxidase
33. 223 27.0% 189 185 309.5 2.9e-10 1fft:C The structure of ubiquinol oxidase from escherichia coli
34. 91 25.0% 88 186 128.3 3.6 4gf0:B Crystal structure of glutahtione transferase homolog from sulfitobacter, target efi-501084, with bound glutathione
35. 91 25.0% 88 208 127.5 4 4gf0:A Crystal structure of glutahtione transferase homolog from sulfitobacter, target efi-501084, with bound glutathione
36. 81 26.6% 64 134 117.1 15 4mxw:X Structure of heterotrimeric lymphotoxin lta1b2 bound to lymp beta receptor ltbr and anti-lta fab
37. 81 26.6% 64 137 116.9 16 4mxv:A Structure of lymphotoxin alpha bound to anti-lta fab
38. 81 26.6% 64 144 116.5 16 1tnr:A Crystal structure of the soluble human 55 kd tnf receptor- human tnf-beta complex: implications for tnf receptor activation
39. 85 25.4% 126 211 113.6 24 1mex:H Antibody catalysis of a bimolecular cycloaddition reaction
40. 90 34.8% 66 675 113.1 25 4nre:A The structure of human 15-lipoxygenase-2 with a substrate mi
41. 77 28.3% 53 120 112.4 28 2l4w:A Nmr structure of the xanthomonas virb7
42. 80 23.6% 110 252 110.9 33 3kcu:A Structure of formate channel
43. 80 26.2% 107 256 110.8 34 1ef8:A Crystal structure of methylmalonyl coa decarboxylase
44. 80 26.2% 107 261 110.6 35 1ef9:A The crystal structure of methylmalonyl coa decarboxylase complexed with 2s-carboxypropyl coa
45. 78 25.3% 79 186 110.5 35 4fqx:C Crystal structure of hla-dm bound to hla-dr1

Number of sequences: 45

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 78 25.3% 79 189 110.3 36 4gbx:C Crystal structure of an immune complex at ph 6.5
2. 79 21.7% 106 232 110.2 37 3q7k:E Formate channel foca from salmonella typhimurium
3. 82 22.0% 141 458 109.1 42 4nlo:A Poliovirus polymerase - c290i loop mutant
4. 82 22.0% 141 457 109.1 42 4nls:A Poliovirus polymerase - s288a loop mutant
5. 91 27.6% 105 239 108.6 45 3kcu:C Structure of formate channel
6. 79 28.9% 83 305 108.1 48 3sob:B * The structure of the first ywtd beta propeller domain of lrp complex with a fab
7. " " " " " "  = 3soq:A *
The structure of the first ywtd beta propeller domain of lrp complex with a dkk1 peptide
8. 79 28.9% 83 306 108.1 48 3sov:A The structure of a beta propeller domain in complex with pep
9. 77 21.5% 93 215 108.0 49 3raj:H Crystal structure of human cd38 in complex with the fab frag antibody hb7

Number of sequences: 9

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer