spacer
spacer

SAS results for UniProt accession no. P17230

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P17230 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P17230 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 30 unique sequences (including 4 consensus sequences) giving 37 sequence matches in all. The 11 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P17230 -----------------------------------------------------------------   Photosystem I reaction center subunit IX OS=Spinacia  ...
2o01:J*-----------------------------------------------------------------×4 The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:J -----------------------------------------------------------------   Improved model of plant photosystem i
1yo9:J -----------------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:J*-----------------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
4kt0:J -----------------------------------------------------------------   Crystal structure of a virus like photosystem i from the  ...
4l6v:F -----------------------------------------------------------------   Crystal structure of a virus like photosystem i from the  ...
2d36:A -----------------------------------------------------------------   The crystal structure of flavin reductase hpac
2d37:A -----------------------------------------------------------------   The crystal structure of flavin reductase hpac complexed wit
2d38:A -----------------------------------------------------------------   The crystal structure of flavin reductase hpac complexed wit
4e70:A -----------------------------------------------------------------   Crystal structure analysis of coniferyl alcohol  ...
2fv2:A -----------------------------------------------------------------   Crystal structure analysis of human rcd-1 conserved region
3iyl:U ----------------------------------------------aqrqffgltynfygqpapl   Atomic cryoem structure of a nonenveloped virus suggests  ...
3k1q:D ---------------------------------------------maqrqffgltynfygqpapl   Backbone model of an aquareovirus virion by cryo-electron  ...
3nd0:A*slhprtlvaaivvglitgvlgagfksavnnmlqwrsqlaqilapipplawlvtalisggmvalsf×2 X-ray crystal structure of a slow cyanobacterial cl-/h+ anti
1bc5:A -----------------------------------------------------------------   Chemotaxis receptor recognition by protein  ...
1af7:A -----------------------------------------------------------------   Cher from salmonella typhimurium
2fjh:L -----------------------------------------------------------------   Structure of the b20-4 fab, a phage derived fab fragment,  ...
4hgm:A -----------------------------------------------------------------   Shark ignar variable domain
2a9i:A -----------------------------------------------------------------   Molecular structure of the interleukin-1 receptor-  ...
3cjs:A -----------------------------------------------------------------   Minimal recognition complex between prma and ribosomal prote

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P17230 -----------------------------------------------------------------   Photosystem I reaction center subunit IX OS=Spinacia  ...
2o01:J*-----------------------------------------------------------------×4 The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:J -----------------------------------------------------------------   Improved model of plant photosystem i
1yo9:J -----------------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:J*-----------------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
4kt0:J -----------------------------------------------------------------   Crystal structure of a virus like photosystem i from the  ...
4l6v:F -----------------------------------------------------------------   Crystal structure of a virus like photosystem i from the  ...
2d36:A -----------------------------------------------------------------   The crystal structure of flavin reductase hpac
2d37:A -----------------------------------------------------------------   The crystal structure of flavin reductase hpac complexed wit
2d38:A -----------------------------------------------------------------   The crystal structure of flavin reductase hpac complexed wit
4e70:A -----------------------------------------------------------------   Crystal structure analysis of coniferyl alcohol  ...
2fv2:A -----------------------------------------------------------------   Crystal structure analysis of human rcd-1 conserved region
3iyl:U fdlndlqelagcyarpwtsrfshlaistgslpvwsarypsvasrnivvntllgahlnpfaggqit   Atomic cryoem structure of a nonenveloped virus suggests  ...
3k1q:D fdlndlqelagcyarpwtsrfshlaistgslpvwsarypsvasrnivvntllgahlnpfaggqit   Backbone model of an aquareovirus virion by cryo-electron  ...
3nd0:A*wlmkrfapdtsgsgipqieghlegklplvwqrvlpiklvggflslgagmlagfegptiqmggsig×2 X-ray crystal structure of a slow cyanobacterial cl-/h+ anti
1bc5:A -----------------------------------------------------------------   Chemotaxis receptor recognition by protein  ...
1af7:A -----------------------------------------------------------------   Cher from salmonella typhimurium
2fjh:L -----------------------------------------------------------------   Structure of the b20-4 fab, a phage derived fab fragment,  ...
4hgm:A -----------------------------------------------------------------   Shark ignar variable domain
2a9i:A -----------------------------------------------------------------   Molecular structure of the interleukin-1 receptor-  ...
3cjs:A -----------------------------------------------------------------   Minimal recognition complex between prma and ribosomal prote

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P17230 -----------------------------------------------------------------   Photosystem I reaction center subunit IX OS=Spinacia  ...
2o01:J*-----------------------------------------------------------------×4 The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:J -----------------------------------------------------------------   Improved model of plant photosystem i
1yo9:J -----------------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:J*-----------------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
4kt0:J -----------------------------------------------------------------   Crystal structure of a virus like photosystem i from the  ...
4l6v:F -----------------------------------------------------------------   Crystal structure of a virus like photosystem i from the  ...
2d36:A -----------------------------------------------------------------   The crystal structure of flavin reductase hpac
2d37:A -----------------------------------------------------------------   The crystal structure of flavin reductase hpac complexed wit
2d38:A -----------------------------------------------------------------   The crystal structure of flavin reductase hpac complexed wit
4e70:A -------------------------------------mdaatavelldaqpqvwhhflgyinsmt   Crystal structure analysis of coniferyl alcohol  ...
2fv2:A -----------------------------------------------------------------   Crystal structure analysis of human rcd-1 conserved region
3iyl:U shqgitwrdpvlsslapvpaiqpppvwavaenvlldsnnyptyvlnlssmwpinqdvhimtmwal   Atomic cryoem structure of a nonenveloped virus suggests  ...
3k1q:D shqgitwrdpvlsslapvpaiqpppvwavaenvlldsnnyptyvlnlssmwpinqdvhimtmwal   Backbone model of an aquareovirus virion by cryo-electron  ...
3nd0:A*qmtggwfkatqenqriliavgagaglatafnaplagvaligeemhprfrsqtlayhsllfgcvma×2 X-ray crystal structure of a slow cyanobacterial cl-/h+ anti
1bc5:A -----------------------------------------------------------------   Chemotaxis receptor recognition by protein  ...
1af7:A ------------------------------------------------------------svllq   Cher from salmonella typhimurium
2fjh:L ---------------------------------diqmtqspsslsasvgdrvtitcrasqvirrs   Structure of the b20-4 fab, a phage derived fab fragment,  ...
4hgm:A --------------------------------------trvdqspsslsasvgdrvtitcvltdt   Shark ignar variable domain
2a9i:A ----------------------------------------------------kpltpstyirnln   Molecular structure of the interleukin-1 receptor-  ...
3cjs:A -----------------------------------------------------------------   Minimal recognition complex between prma and ribosomal prote

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P17230 -----------------------------------------------mrdfktylsv--apvlst   Photosystem I reaction center subunit IX OS=Spinacia  ...
2o01:J*-----------------------------------------------MRDFKTYLSV--APVLST×4 The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:J -----------------------------------------------MRDLKTYLSV--APVVST   Improved model of plant photosystem i
1yo9:J -----------------------------------------------MRDLKTYLSV--APVLST   Theoretical model of plant photosystem i
1jb0:J*-----------------------------------------------MKHFLTYLST--APVLAA×3 Crystal structure of photosystem i: a photosynthetic  ...
4kt0:J -----------------------------------------------MDGLKSFLST--APVMIM   Crystal structure of a virus like photosystem i from the  ...
4l6v:F -----------------------------------------------MDGLKSFLST--APVMIM   Crystal structure of a virus like photosystem i from the  ...
2d36:A ---------------------------------------maeviksimrkfp--lgv--a-ivtt   The crystal structure of flavin reductase hpac
2d37:A ---------------------------------------maeviksimrkfp--lgv--a-ivtt   The crystal structure of flavin reductase hpac complexed wit
2d38:A ---------------------------------------maeviksimrkfp--lgv--a-ivtt   The crystal structure of flavin reductase hpac complexed wit
4e70:A lqcaleldiadvihrhghpiplnqlaaaleipqtkapflsrlmrmlvhlgyftqvit--kpvlps   Crystal structure analysis of coniferyl alcohol  ...
2fv2:A --------------------------rekiyqwinelsspetrenallelskkresv--pdlapm   Crystal structure analysis of human rcd-1 conserved region
3iyl:U sdqgpiyhlevpvdpmpaattaalmaytgvpiahlaqtayrfagqlpqspdstmvst--irwlsa   Atomic cryoem structure of a nonenveloped virus suggests  ...
3k1q:D sdqgpiyhlevpvdpmpaattaalmaytgvpiahlaqtayrfagqlpqspdstmvst--irwlsa   Backbone model of an aquareovirus virion by cryo-electron  ...
3nd0:A*tiilrmirgqsaiisltefkrvpldslwmfiilgilfgvmgytfnrglfkvldwfdr--lpplat×2 X-ray crystal structure of a slow cyanobacterial cl-/h+ anti
1bc5:A mtqrlalsdahfrricqliyqragivladhkrdmvynrlvrrlralglddfgrylsmleanqnsa   Chemotaxis receptor recognition by protein  ...
1af7:A mtqrlalsdahfrricqliyqragivladhkrdmvynrlvrrlralglddfgrylsmleanqnsa   Cher from salmonella typhimurium
2fjh:L lawyqqkpgkapklliyaasnlasgvpsrfsgsgsgtdftltisslqpedfatyycq--qsntsp   Structure of the b20-4 fab, a phage derived fab fragment,  ...
4hgm:A syplystywyqqkpgssnkeqisisgrysesvnkgtksftltisslqpedfatyycr--a-mgtn   Shark ignar variable domain
2a9i:A vgilrklsdfidpqegwkklavaikkpsgddrynqfhirrfeallqtglsptcellf--dwgttn   Molecular structure of the interleukin-1 receptor-  ...
3cjs:A --------------------------------------------mwvyrlkgtleal--dpilpg   Minimal recognition complex between prma and ribosomal prote

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P17230 lw--fgslaglli---einrff--pdaltfpffsf------------------------------   Photosystem I reaction center subunit IX OS=Spinacia  ...
2o01:J*LW--FGSLAGLLI---EINRFF--PDALTFPFF--------------------------------×4 The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:J LW--FGALAGLLI---EINRFF--PDALIFPFF--------------------------------   Improved model of plant photosystem i
1yo9:J LW--FGSLAGLLI---EINRLF--PDALTFPF---------------------------------   Theoretical model of plant photosystem i
1jb0:J*IW--MTITAGILI---EFNRFY--PDLLFHPL---------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
4kt0:J AL--LTFTAGILI---EFNRFY--PDLLFHP----------------------------------   Crystal structure of a virus like photosystem i from the  ...
4l6v:F AL--LTFTAGILI---EFNAFY--PDLLFHPCSCAGDFLIPSIIFLYIAGWIGWVGRSYLIEIRE   Crystal structure of a virus like photosystem i from the  ...
2d36:A nw--kgelvgmtv-----ntfn--slslnpplvsffadrmkgndipykeskyfvvnftdneelfn   The crystal structure of flavin reductase hpac
2d37:A nw--kgelvgmtv-----ntfn--slslnpplvsffadrmkgndipykeskyfvvnftdneelfn   The crystal structure of flavin reductase hpac complexed wit
2d38:A nw--kgelvgmtv-----ntfn--slslnpplvsffadrmkgndipykeskyfvvnftdneelfn   The crystal structure of flavin reductase hpac complexed wit
4e70:A yw--laplsrlll---kqnpyn--arsltfcsvhehlvdpwrqmsawlrtgkedgkdtpnafafa   Crystal structure analysis of coniferyl alcohol  ...
2fv2:A lwhsfgtiaallq---eivniy--psinpptltahqsnrvcnalallqcvashpetrsaflaahi   Crystal structure analysis of human rcd-1 conserved region
3iyl:U iw--fgsltgrln---rsrtcn--gfyfefakpalnpdqavlkwndgaraappaaaqssyircis   Atomic cryoem structure of a nonenveloped virus suggests  ...
3k1q:D iw--fgsltgrln---rsrtcn--gfyfefakpalnpdqavlkwndgaraappaaaqssyircis   Backbone model of an aquareovirus virion by cryo-electron  ...
3nd0:A*kw--kgfllgsii---gilslf--plpltdggdnavlwafnsqshfstlilvfcgrflltlicyg×2 X-ray crystal structure of a slow cyanobacterial cl-/h+ anti
1bc5:A ew--qafinaltt---nltaff--reahhfpilaeharrrhgeyrvwsaaastgeepysiaitla   Chemotaxis receptor recognition by protein  ...
1af7:A ew--qafinaltt---nltaff--reahhfpilaeharrrhgeyrvwsaaastgeepysiaitla   Cher from salmonella typhimurium
2fjh:L lt--fgq--gtkv---eikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdna   Structure of the b20-4 fab, a phage derived fab fragment,  ...
4hgm:A iw--tgdgagtkv---eik----------------------------------------------   Shark ignar variable domain
2a9i:A ct--vgdlvdllv---qielfa--patlllpdavpq-----------------------------   Molecular structure of the interleukin-1 receptor-  ...
3cjs:A lf--dggarglweregevwaff--papvdlpyegvweevgdew----------------------   Minimal recognition complex between prma and ribosomal prote

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P17230 -----------------------------------------------------------------   Photosystem I reaction center subunit IX OS=Spinacia  ...
2o01:J*-----------------------------------------------------------------×4 The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:J -----------------------------------------------------------------   Improved model of plant photosystem i
1yo9:J -----------------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:J*-----------------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
4kt0:J -----------------------------------------------------------------   Crystal structure of a virus like photosystem i from the  ...
4l6v:F SKNPEMQEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR--------------   Crystal structure of a virus like photosystem i from the  ...
2d36:A ifalkpvkerfreikykegiggcpilydsyayieaklydtidvgdhsiivgevidgyqirdnftp   The crystal structure of flavin reductase hpac
2d37:A ifalkpvkerfreikykegiggcpilydsyayieaklydtidvgdhsiivgevidgyqirdnftp   The crystal structure of flavin reductase hpac complexed wit
2d38:A ifalkpvkerfreikykegiggcpilydsyayieaklydtidvgdhsiivgevidgyqirdnftp   The crystal structure of flavin reductase hpac complexed wit
4e70:A hegkkvyevcsedanfsqlfsegmagdswlfsralvskcrdafeglsslvdvgggtgntskviae   Crystal structure analysis of coniferyl alcohol  ...
2fv2:A plflypflhtvsktrpfeylrltslgvigalvktdeqevinflltteiiplclrimesgselskt   Crystal structure analysis of human rcd-1 conserved region
3iyl:U phwqhqivevagalmsqsvtavtglpalideatlpawsqgvanltgngqgvvpcldynpvpmaaa   Atomic cryoem structure of a nonenveloped virus suggests  ...
3k1q:D phwqhqivevagalmsqsvtavtglpalideatlpawsqgvanltgngqgvvpcldynpvpmaaa   Backbone model of an aquareovirus virion by cryo-electron  ...
3nd0:A*sgaiggifapmlgiasivsvamarhfhllfpsqipepavmaiagmgalvaatvrapltailltie×2 X-ray crystal structure of a slow cyanobacterial cl-/h+ anti
1bc5:A dalgmapgrwkvfasdidtevlekarsgiyrlselktlspqqlqryfmrgtgpheglvrvrqela   Chemotaxis receptor recognition by protein  ...
1af7:A dalgmapgrwkvfasdidtevlekarsgiyrlselktlspqqlqryfmrgtgpheglvrvrqela   Cher from salmonella typhimurium
2fjh:L lqsgnsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec----   Structure of the b20-4 fab, a phage derived fab fragment,  ...
4hgm:A -----------------------------------------------------------------   Shark ignar variable domain
2a9i:A -----------------------------------------------------------------   Molecular structure of the interleukin-1 receptor-  ...
3cjs:A -----------------------------------------------------------------   Minimal recognition complex between prma and ribosomal prote

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P17230 -----------------------------------------------------------------   Photosystem I reaction center subunit IX OS=Spinacia  ...
2o01:J*-----------------------------------------------------------------×4 The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:J -----------------------------------------------------------------   Improved model of plant photosystem i
1yo9:J -----------------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:J*-----------------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
4kt0:J -----------------------------------------------------------------   Crystal structure of a virus like photosystem i from the  ...
4l6v:F -----------------------------------------------------------------   Crystal structure of a virus like photosystem i from the  ...
2d36:A lvymnrkyykls-----------------------------------------------------   The crystal structure of flavin reductase hpac
2d37:A lvymnrkyyklss----------------------------------------------------   The crystal structure of flavin reductase hpac complexed wit
2d38:A lvymnrkyyklssl---------------------------------------------------   The crystal structure of flavin reductase hpac complexed wit
4e70:A tfpnihctvfdlphvvsgpkqthpnldyesgnmftdeiphadavlfkwvlcdwpdepvlkmlkqc   Crystal structure analysis of coniferyl alcohol  ...
2fv2:A vatfilqkillddtglayicqtyerfshvamilgkmvlqlskepsarllkhvvrcylrlsdnpra   Crystal structure analysis of human rcd-1 conserved region
3iyl:U rhlqwrqdglitaaqeaqlnndytayaltierhltamlvanpiaagrmpiqpfnaadfgqagqta   Atomic cryoem structure of a nonenveloped virus suggests  ...
3k1q:D rhlqwrqdglitaaqeaqlnndytayaltierhltamlvanpiaagrmpiqpfnaadfgqagqta   Backbone model of an aquareovirus virion by cryo-electron  ...
3nd0:A*mtdnyfvilpllvtclvasvvaealggkpiytvllertlakqnr---------------------×2 X-ray crystal structure of a slow cyanobacterial cl-/h+ anti
1bc5:A nyvefssvnllekqynvpgpfdaifcrnvmiyfdkttqedilrrfvpllkpdgllfaghsenfsn   Chemotaxis receptor recognition by protein  ...
1af7:A nyvefssvnllekqynvpgpfdaifcrnvmiyfdkttqedilrrfvpllkpdgllfaghsenfsn   Cher from salmonella typhimurium
2fjh:L -----------------------------------------------------------------   Structure of the b20-4 fab, a phage derived fab fragment,  ...
4hgm:A -----------------------------------------------------------------   Shark ignar variable domain
2a9i:A -----------------------------------------------------------------   Molecular structure of the interleukin-1 receptor-  ...
3cjs:A -----------------------------------------------------------------   Minimal recognition complex between prma and ribosomal prote

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P17230 -----------------------------------------------------------------   Photosystem I reaction center subunit IX OS=Spinacia  ...
2o01:J*-----------------------------------------------------------------×4 The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:J -----------------------------------------------------------------   Improved model of plant photosystem i
1yo9:J -----------------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:J*-----------------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
4kt0:J -----------------------------------------------------------------   Crystal structure of a virus like photosystem i from the  ...
4l6v:F -----------------------------------------------------------------   Crystal structure of a virus like photosystem i from the  ...
2d36:A -----------------------------------------------------------------   The crystal structure of flavin reductase hpac
2d37:A -----------------------------------------------------------------   The crystal structure of flavin reductase hpac complexed wit
2d38:A -----------------------------------------------------------------   The crystal structure of flavin reductase hpac complexed wit
4e70:A kkaltkkgklmiadhvldhescndsnsmgtslildmlfmsflegslrtekqwaklfaeagfkdyk   Crystal structure analysis of coniferyl alcohol  ...
2fv2:A realrqclpdqlkdttfaqvlkddtttkrwlaqlvknlqe-------------------------   Crystal structure analysis of human rcd-1 conserved region
3iyl:U aavalaqamfv------------------------------------------------------   Atomic cryoem structure of a nonenveloped virus suggests  ...
3k1q:D aavalaqamfv------------------------------------------------------   Backbone model of an aquareovirus virion by cryo-electron  ...
3nd0:A*-----------------------------------------------------------------×2 X-ray crystal structure of a slow cyanobacterial cl-/h+ anti
1bc5:A lvrefslrgqtvyals-------------------------------------------------   Chemotaxis receptor recognition by protein  ...
1af7:A lvrefslrgqtvyals-------------------------------------------------   Cher from salmonella typhimurium
2fjh:L -----------------------------------------------------------------   Structure of the b20-4 fab, a phage derived fab fragment,  ...
4hgm:A -----------------------------------------------------------------   Shark ignar variable domain
2a9i:A -----------------------------------------------------------------   Molecular structure of the interleukin-1 receptor-  ...
3cjs:A -----------------------------------------------------------------   Minimal recognition complex between prma and ribosomal prote

                5     
                3     
       123456789012345                                                     Protein name
       ---------+-----                                                     ------------
P17230 ---------------                                                     Photosystem I reaction center subunit IX OS=Spinacia  ...
2o01:J*---------------                                                  ×4 The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:J ---------------                                                     Improved model of plant photosystem i
1yo9:J ---------------                                                     Theoretical model of plant photosystem i
1jb0:J*---------------                                                  ×3 Crystal structure of photosystem i: a photosynthetic  ...
4kt0:J ---------------                                                     Crystal structure of a virus like photosystem i from the  ...
4l6v:F ---------------                                                     Crystal structure of a virus like photosystem i from the  ...
2d36:A ---------------                                                     The crystal structure of flavin reductase hpac
2d37:A ---------------                                                     The crystal structure of flavin reductase hpac complexed wit
2d38:A ---------------                                                     The crystal structure of flavin reductase hpac complexed wit
4e70:A itpvgglrvlievyp                                                     Crystal structure analysis of coniferyl alcohol  ...
2fv2:A ---------------                                                     Crystal structure analysis of human rcd-1 conserved region
3iyl:U ---------------                                                     Atomic cryoem structure of a nonenveloped virus suggests  ...
3k1q:D ---------------                                                     Backbone model of an aquareovirus virion by cryo-electron  ...
3nd0:A*---------------                                                  ×2 X-ray crystal structure of a slow cyanobacterial cl-/h+ anti
1bc5:A ---------------                                                     Chemotaxis receptor recognition by protein  ...
1af7:A ---------------                                                     Cher from salmonella typhimurium
2fjh:L ---------------                                                     Structure of the b20-4 fab, a phage derived fab fragment,  ...
4hgm:A ---------------                                                     Shark ignar variable domain
2a9i:A ---------------                                                     Molecular structure of the interleukin-1 receptor-  ...
3cjs:A ---------------                                                     Minimal recognition complex between prma and ribosomal prote

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P17230. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 44 - - P17230 Photosystem I reaction center subunit IX OS=Spinacia oleracea GN=psaJ PE=1 SV=2
2. 281 100.0% 42 42 534.1 8.8e-23 2o01:J * The structure of a plant photosystem i supercomplex at 3.4 a resolution
3. " " " " " "  = 2wsc:J *
Improved model of plant photosystem i
4. " " " " " "  = 2wse:J *
Improved model of plant photosystem i
5. " " " " " "  = 2wsf:J *
Improved model of plant photosystem i
6. 260 90.5% 42 42 495.0 1.3e-20 3lw5:J Improved model of plant photosystem i
7. 259 95.1% 41 41 493.4 1.6e-20 1yo9:J Theoretical model of plant photosystem i
8. 160 56.1% 41 41 309.1 3e-10 1jb0:J * Crystal structure of photosystem i: a photosynthetic reactio and core antenna system from cyanobacteria
9. " " " " " "  = 3pcq:J *
Femtosecond x-ray protein nanocrystallography
10. " " " " " "  = 4fe1:J *
Improving the accuracy of macromolecular structure refinemen resolution
11. 122 47.5% 40 40 238.6 2.5e-06 4kt0:J Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
12. 113 45.0% 40 125 211.4 8.4e-05 4l6v:F Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
13. 70 38.6% 44 154 129.4 3.1 2d36:A The crystal structure of flavin reductase hpac
14. 70 38.6% 44 155 129.3 3.1 2d37:A The crystal structure of flavin reductase hpac complexed wit
15. 70 38.6% 44 156 129.3 3.1 2d38:A The crystal structure of flavin reductase hpac complexed wit
16. 69 35.3% 34 359 119.7 11 4e70:A Crystal structure analysis of coniferyl alcohol 9-o-methyltr from linum nodiflorum in complex with coniferyl alcohol
17. 65 40.6% 32 267 115.0 19 2fv2:A Crystal structure analysis of human rcd-1 conserved region
18. 67 52.4% 21 411 114.8 20 3iyl:U Atomic cryoem structure of a nonenveloped virus suggests how penetration protein is primed for cell entry
19. 67 52.4% 21 412 114.8 20 3k1q:D Backbone model of an aquareovirus virion by cryo-electron microscopy and bioinformatics
20. 67 48.1% 27 425 114.5 21 3nd0:A * X-ray crystal structure of a slow cyanobacterial cl-/h+ anti
21. " " " " " "  = 3q17:A *
Structure of a slow clc cl-/h+ antiporter from a cyanobacter bromide
22. 64 31.1% 45 269 113.1 25 1bc5:A Chemotaxis receptor recognition by protein methyltransferase cher
23. 64 31.1% 45 274 112.9 25 1af7:A Cher from salmonella typhimurium
24. 62 37.5% 40 214 111.5 31 2fjh:L Structure of the b20-4 fab, a phage derived fab fragment, in with vegf
25. 58 40.7% 27 103 110.8 33 4hgm:A Shark ignar variable domain
26. 58 42.9% 21 105 110.6 34 2a9i:A Molecular structure of the interleukin-1 receptor- associated kinase-4 death domain
27. 55 30.8% 39 58 110.5 35 3cjs:A Minimal recognition complex between prma and ribosomal prote

Number of sequences: 27

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 63 37.5% 32 294 110.4 35 1y37:A Structure of fluoroacetate dehalogenase from burkholderia sp
2. 63 37.5% 32 294 110.4 35 3b12:A Crystal structure of the fluoroacetate dehalogenase d104 mut burkholderia sp. Fa1 in complex with fluoroacetate
3. 61 37.5% 40 211 109.8 38 3efd:L The crystal structure of the cytoplasmic domain of kcsa
4. 58 42.9% 21 127 108.8 43 1wh4:A Solution structure of the death domain of interleukin-1 receptor-associated kinase4 (irak4) from mus musculus
5. 67 32.4% 37 791 108.7 43 2nya:A Crystal structure of the periplasmic nitrate reductase (nap) from escherichia coli
6. 57 25.0% 44 106 108.6 44 1si9:A * Boiling stable protein isolated from populus tremula
7. " " " " " "  = 1tr0:A *
Crystal structure of a boiling stable protein sp1
8. 60 57.1% 14 196 108.6 44 3ckk:A Crystal structure of human methyltransferase-like protein 1
9. 57 25.0% 44 108 108.5 45 1rl7:A Model structure of sp1 (stable protein 1) from aspen plant
10. 60 35.0% 40 211 107.9 48 4g80:B Crystal structure of voltage sensing domain of ci-vsp with f antibody (wt, 3.8 a)
11. 58 35.3% 34 142 107.8 49 3md2:A Crystal structure of the matrix protein 1 from influenza a v (a/california/04/2009 (h1n1))

Number of sequences: 11

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer