spacer
spacer

SAS results for UniProt accession no. Q9S831

Sequence annotated by structure
>

Key:
Sec. struc: Predicted
  Helix Strand

Predicted secondary structure (green) comes from the DSC program. The lighter the green the less certain the prediction.

 

FASTA alignment for UniProt accession no. Q9S831 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q9S831 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 18 unique sequences (including 6 consensus sequences) giving 27 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q9S831 -----------------------------------------------------------------   Photosystem I reaction center subunit IV A, chloroplastic  ...
2wsc:E*-----------------------------------------------------------------×3 Improved model of plant photosystem i
2o01:E -----------------------------------------------------------------   The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:E -----------------------------------------------------------------   Improved model of plant photosystem i
1yo9:E -----------------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:E*-----------------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
1qp2:A*-----------------------------------------------------------------×2 Solution structure of photosystem i accessory protein e  ...
1pse:A*-----------------------------------------------------------------×2 The three-dimensional solution structure of psae from the  ...
1gxi:E -----------------------------------------------------------------   Psae sub-unit of the photosystem i of the cyanobacterium  ...
4kt0:E*-----------------------------------------------------------------×2 Crystal structure of a virus like photosystem i from the  ...
2nxo:A -----------------------------------------------------------------   Crystal structure of protein sco4506 from streptomyces  ...
2kr0:A mttsgalfpslvpgsrgasnkylvefragkmslkgttvtpdkrkglvyiqqtddslihfcwkdrt   A proteasome protein
2qdn:A*-----------------------------------------------------------------×3 Crystal structure of mouse gitrl
2q8o:A -----------------------------------------------------------------   Crystal structure of mouse gitr ligand dimer
3gvg:A -------------------------------------------srkpliagnwkmnlnhyeaial   Crystal structure of triosephosphate isomerase from  ...
3ta6:A --------------------------------------------rkpliagnwkmnlnhyeaial   Structure of mycobacterium tuberculosis triosephosphate isom
3tao:A -------------------------------------------srkpliagnwkmnlnhyeaial   Structure of mycobacterium tuberculosis triosephosphate  ...
1r76:A -----------------------------------------------------------------   Structure of a pectate lyase from azospirillum irakense
4k90:B -----------------------------------------------------------------   Extracellular metalloproteinase from aspergillus

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q9S831 -----------------------------------------------------------------   Photosystem I reaction center subunit IV A, chloroplastic  ...
2wsc:E*-----------------------------------------------------------------×3 Improved model of plant photosystem i
2o01:E -----------------------------------------------------------------   The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:E -----------------------------------------------------------------   Improved model of plant photosystem i
1yo9:E -----------------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:E*-----------------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
1qp2:A*-----------------------------------------------------------------×2 Solution structure of photosystem i accessory protein e  ...
1pse:A*-----------------------------------------------------------------×2 The three-dimensional solution structure of psae from the  ...
1gxi:E -----------------------------------------------------------------   Psae sub-unit of the photosystem i of the cyanobacterium  ...
4kt0:E*-----------------------------------------------------------------×2 Crystal structure of a virus like photosystem i from the  ...
2nxo:A ------------------------------trprvghiqflnclplywglartgtlldfeltkdt   Crystal structure of protein sco4506 from streptomyces  ...
2kr0:A sgnveddliifpddcefkrvpqcpsgrvyvlkfkagskrlffwmqepktdqdeehcrkvneylnn   A proteasome protein
2qdn:A*-----------------------------------------------------------------×3 Crystal structure of mouse gitrl
2q8o:A -----------------------------------------------------------------   Crystal structure of mouse gitr ligand dimer
3gvg:A vqkiafslpdkyydrvdvavippftdlrsvqtlvdgdklrltygaqdlsphdsgaytgdvsgafl   Crystal structure of triosephosphate isomerase from  ...
3ta6:A vqkiafslpdkyydrvdvavippftdlrsvqtlvdgdklrltygaqdlsphdsgaytgdvsgafl   Structure of mycobacterium tuberculosis triosephosphate isom
3tao:A vqkiafslpdkyydrvdvavippftdlrsvqtlvdgdklrltygaqdlsphdsgaytgdvsgafl   Structure of mycobacterium tuberculosis triosephosphate  ...
1r76:A -----------------------------------------------------------------   Structure of a pectate lyase from azospirillum irakense
4k90:B --------------------------------------------------tvdlnafrlkslaky   Extracellular metalloproteinase from aspergillus

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q9S831 ---------------------------------------mamttastvfvlpanvtsvagasssr   Photosystem I reaction center subunit IV A, chloroplastic  ...
2wsc:E*-----------------------------------------------------------------×3 Improved model of plant photosystem i
2o01:E -----------------------------------------------------------------   The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:E -----------------------------------------------------------------   Improved model of plant photosystem i
1yo9:E -----------------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:E*-----------------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
1qp2:A*-----------------------------------------------------------------×2 Solution structure of photosystem i accessory protein e  ...
1pse:A*-----------------------------------------------------------------×2 The three-dimensional solution structure of psae from the  ...
1gxi:E -----------------------------------------------------------------   Psae sub-unit of the photosystem i of the cyanobacterium  ...
4kt0:E*-----------------------------------------------------------------×2 Crystal structure of a virus like photosystem i from the  ...
2nxo:A peklseqlvrgdldigpvtlveflknaddlvafpdiavgcdgpvmscvivsqvpldrldgarval   Crystal structure of protein sco4506 from streptomyces  ...
2kr0:A ppmpgalgasgssghelsalggegglqsllgnmshsqlmqligpaglgglgglgaltgpglasll   A proteasome protein
2qdn:A*-----------------------------------------------------------------×3 Crystal structure of mouse gitrl
2q8o:A -----------------------------------------------------------------   Crystal structure of mouse gitr ligand dimer
3gvg:A aklgcsyvvvghserrtyhneddalvaakaatalkhgltpivcigehldvreagnhvahnieqlr   Crystal structure of triosephosphate isomerase from  ...
3ta6:A aklgcsyvvvghserrtyhneddalvaakaatalkhgltpivcigehldvreagnhvahnieqlr   Structure of mycobacterium tuberculosis triosephosphate isom
3tao:A aklgcsyvvvghserrtyhneddalvaakaatalkhgltpivcigehldvreagnhvahnieqlr   Structure of mycobacterium tuberculosis triosephosphate  ...
1r76:A ---------------------------------------------------avigmneaasaltp   Structure of a pectate lyase from azospirillum irakense
4k90:B vnatetvieapspqsyvevatqhvkmiapdatfrvvddhyvgdngvahvhfrqtangldidnadf   Extracellular metalloproteinase from aspergillus

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q9S831 ssvsflp--mrnagsrlvvraaedpapasssskdspaaaaapdgatatkpkpppigpkrgskvk-   Photosystem I reaction center subunit IV A, chloroplastic  ...
2wsc:E*------------------------------------------------------igpkrgskvk-×3 Improved model of plant photosystem i
2o01:E --------------------------------------------------------pkrgskvk-   The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:E ------------------------------------------------------igpkrgakvk-   Improved model of plant photosystem i
1yo9:E ------------------------------------------------------rgpkrgtkvk-   Theoretical model of plant photosystem i
1jb0:E*--------------------------------------------------------vqrgskvk-×3 Crystal structure of photosystem i: a photosynthetic  ...
1qp2:A*-------------------------------------------------------mvqrgskvr-×2 Solution structure of photosystem i accessory protein e  ...
1pse:A*-------------------------------------------------------aiergskvk-×2 The three-dimensional solution structure of psae from the  ...
1gxi:E -------------------------------------------------------alnrgdkvr-   Psae sub-unit of the photosystem i of the cyanobacterium  ...
4kt0:E*-------------------------------------------------------alnrgdkvr-×2 Crystal structure of a virus like photosystem i from the  ...
2nxo:A gstsrts--vrlaqlllserfgvqp-dyytcppdlslmaavligdaalranmid-gprygldvhd   Crystal structure of protein sco4506 from streptomyces  ...
2kr0:A gssgppg--sssssssrsqsaavtpssttsstratpapsa-paaasatspspap-ssgngasta-   A proteasome protein
2qdn:A*--------------------------------scmvkfelssskwhmtspkphcvnttsdgklk-×3 Crystal structure of mouse gitrl
2q8o:A ------------------------------iescmvkfelssskwhmtspkphcvnttsdgklk-   Crystal structure of mouse gitr ligand dimer
3gvg:A gslagll--aeqigsvvi---ayepvwaigtgrvasaadaqevcaairkelaslaspriadtvr-   Crystal structure of triosephosphate isomerase from  ...
3ta6:A gslagll--aeqigsvvi---ayepvwaigtgrvasaadaqevcaairkelaslaspriadtvr-   Structure of mycobacterium tuberculosis triosephosphate isom
3tao:A gslagll--aeqigsvvi---ayepvwaigtgrvasaadaqevcaairkelaslaspriadtvr-   Structure of mycobacterium tuberculosis triosephosphate  ...
1r76:A srvsslpdtqraawqeylarseaq----lsrdkaslaaelapg-----qplppppaegkgadtm-   Structure of a pectate lyase from azospirillum irakense
4k90:B nvnvgkd--gkvfsygnsfytgqipssaaltkrdfsdpvtalkgttntlqlpitvdsassestk-   Extracellular metalloproteinase from aspergillus

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q9S831 --ilrresywf-----knvgsvvavdqdp-ktrypvvvrfakvny-------anis-------tn   Photosystem I reaction center subunit IV A, chloroplastic  ...
2wsc:E*--ilrresywf-----knvgsvvavdqdp-ktrypvvvrfakvny-------anis-------tn×3 Improved model of plant photosystem i
2o01:E --ilrresywf-----knvgsvvavdqdp-ktrypvvvrfakvny-------anis-------tn   The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:E --ilrkesywy-----kgtgsvvavdqdp-ntrypvvvrfnkvny-------anvs-------tn   Improved model of plant photosystem i
1yo9:E --ilrresywy-----ngtgsvvtvdqdp-ntrypvvvrfakvny-------agvs-------tn   Theoretical model of plant photosystem i
1jb0:E*--ilrpesywy-----nevgtvasvdqtp-gvkypvivrfdkvnytgysgsasgvn-------tn×3 Crystal structure of photosystem i: a photosynthetic  ...
1qp2:A*--ilrpesywf-----qdvgtvasvdqsg--ikypvivrfekvny-------sgin-------tn×2 Solution structure of photosystem i accessory protein e  ...
1pse:A*--ilrkesywy-----gdvgtvasidksg-ii-ypvivrfnkvny-------ngfsgsagglntn×2 The three-dimensional solution structure of psae from the  ...
1gxi:E --ikrtesywy-----gdvgtvasveksg-il-ypvivrfdrvnyngfsgsasgvn-------tn   Psae sub-unit of the photosystem i of the cyanobacterium  ...
4kt0:E*--ikrtesywy-----gdvgtvasveksg--ilypvivrfdrvnyngfsgsasgvn-------tn×2 Crystal structure of a virus like photosystem i from the  ...
2nxo:A lgalwkewtgl-----pfvfavwaarrdy-aerepvitr--kvhe-------afla-------sr   Crystal structure of protein sco4506 from streptomyces  ...
2kr0:A --asptqpiql-----sdlqsilatmnvp-agpaggqqvdlasvl-------tpei-------ma   A proteasome protein
2qdn:A*--ilqsgtyli-------ygqvipvdkkyikdnapfvvqiykknd-------vlqt-------lm×3 Crystal structure of mouse gitrl
2q8o:A --ilqsgtyli-------ygqvipvdkkyikdnapfvvqiykknd-------vlqt-------lm   Crystal structure of mouse gitr ligand dimer
3gvg:A --vlyggsvna-----knvgdivaqddvd-gglvggasldgehfa-------tlaa-------ia   Crystal structure of triosephosphate isomerase from  ...
3ta6:A --vlyggsvna-----knvgdivaqddvd-gglvggasldgehfa-------tlaa-------ia   Structure of mycobacterium tuberculosis triosephosphate isom
3tao:A --vlyggsvna-----knvgdivaqddvd-gglvggasldgehfa-------tlaa-------ia   Structure of mycobacterium tuberculosis triosephosphate  ...
1r76:A --pldkpaawytskaarhvadvivsfqtp-aggwgknqprdgalr-------lpgq-------hy   Structure of a pectate lyase from azospirillum irakense
4k90:B ------esyvf-----kgvsgtvs---dp-kak---lvyfvkddg-------tlal-------aw   Extracellular metalloproteinase from aspergillus

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q9S831 nyaldeveevaa-----------------------------------------------------   Photosystem I reaction center subunit IV A, chloroplastic  ...
2wsc:E*nyaldeveevaa-----------------------------------------------------×3 Improved model of plant photosystem i
2o01:E nyaldeveeva------------------------------------------------------   The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:E nyaldeiveve------------------------------------------------------   Improved model of plant photosystem i
1yo9:E nyaldeikeva------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:E*nfalhevqeva------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
1qp2:A*nfaedelveveapkakpkk----------------------------------------------×2 Solution structure of photosystem i accessory protein e  ...
1pse:A*nfaehelevvg------------------------------------------------------×2 The three-dimensional solution structure of psae from the  ...
1gxi:E nfaenelelvqaaak--------------------------------------------------   Psae sub-unit of the photosystem i of the cyanobacterium  ...
4kt0:E*nfaenelelv-------------------------------------------------------×2 Crystal structure of a virus like photosystem i from the  ...
2nxo:A nlsleevekvaeqaarweafdedtlakyfttldfrfgapqleavtefarrvgpttgfpadvkvel   Crystal structure of protein sco4506 from streptomyces  ...
2kr0:A pilanadvqerllpylpsgeslpqtadeiqntltspqfqqalgmfsaalasgqlgplmcqfglpa   A proteasome protein
2qdn:A*ndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlpfis----------------×3 Crystal structure of mouse gitrl
2q8o:A ndfqilpiggvyelhagdniylkfnskdhiqknntywgiilmpdlpfis----------------   Crystal structure of mouse gitr ligand dimer
3gvg:A ag---------------------------------------------------------------   Crystal structure of triosephosphate isomerase from  ...
3ta6:A ag---------------------------------------------------------------   Structure of mycobacterium tuberculosis triosephosphate isom
3tao:A ag---------------------------------------------------------------   Structure of mycobacterium tuberculosis triosephosphate  ...
1r76:A tgenvakvkrdrdwhyvgtidndatvteirflaqvvsqlapeeaapyrdaalkgieyllasqfpn   Structure of a pectate lyase from azospirillum irakense
4k90:B rvetdidsnwlltyidaksgeeihgvvdyvae---------------------------------   Extracellular metalloproteinase from aspergillus

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q9S831 -----------------------------------------------------------------   Photosystem I reaction center subunit IV A, chloroplastic  ...
2wsc:E*-----------------------------------------------------------------×3 Improved model of plant photosystem i
2o01:E -----------------------------------------------------------------   The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:E -----------------------------------------------------------------   Improved model of plant photosystem i
1yo9:E -----------------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:E*-----------------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
1qp2:A*-----------------------------------------------------------------×2 Solution structure of photosystem i accessory protein e  ...
1pse:A*-----------------------------------------------------------------×2 The three-dimensional solution structure of psae from the  ...
1gxi:E -----------------------------------------------------------------   Psae sub-unit of the photosystem i of the cyanobacterium  ...
4kt0:E*-----------------------------------------------------------------×2 Crystal structure of a virus like photosystem i from the  ...
2nxo:A lkp--------------------------------------------------------------   Crystal structure of protein sco4506 from streptomyces  ...
2kr0:A eaveaankgdveafakamqnnakpeqkegdtkdkkdeeedmsld---------------------   A proteasome protein
2qdn:A*-----------------------------------------------------------------×3 Crystal structure of mouse gitrl
2q8o:A -----------------------------------------------------------------   Crystal structure of mouse gitr ligand dimer
3gvg:A -----------------------------------------------------------------   Crystal structure of triosephosphate isomerase from  ...
3ta6:A -----------------------------------------------------------------   Structure of mycobacterium tuberculosis triosephosphate isom
3tao:A -----------------------------------------------------------------   Structure of mycobacterium tuberculosis triosephosphate  ...
1r76:A ggwpqvwpleggyhdaitynddalvhvaellsdiaagrdgfgfvppairtraleatnaaihcive   Structure of a pectate lyase from azospirillum irakense
4k90:B -----------------------------------------------------------------   Extracellular metalloproteinase from aspergillus

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q9S831 -----------------------------------------------------------------   Photosystem I reaction center subunit IV A, chloroplastic  ...
2wsc:E*-----------------------------------------------------------------×3 Improved model of plant photosystem i
2o01:E -----------------------------------------------------------------   The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:E -----------------------------------------------------------------   Improved model of plant photosystem i
1yo9:E -----------------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:E*-----------------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
1qp2:A*-----------------------------------------------------------------×2 Solution structure of photosystem i accessory protein e  ...
1pse:A*-----------------------------------------------------------------×2 The three-dimensional solution structure of psae from the  ...
1gxi:E -----------------------------------------------------------------   Psae sub-unit of the photosystem i of the cyanobacterium  ...
4kt0:E*-----------------------------------------------------------------×2 Crystal structure of a virus like photosystem i from the  ...
2nxo:A -----------------------------------------------------------------   Crystal structure of protein sco4506 from streptomyces  ...
2kr0:A -----------------------------------------------------------------   A proteasome protein
2qdn:A*-----------------------------------------------------------------×3 Crystal structure of mouse gitrl
2q8o:A -----------------------------------------------------------------   Crystal structure of mouse gitr ligand dimer
3gvg:A -----------------------------------------------------------------   Crystal structure of triosephosphate isomerase from  ...
3ta6:A -----------------------------------------------------------------   Structure of mycobacterium tuberculosis triosephosphate isom
3tao:A -----------------------------------------------------------------   Structure of mycobacterium tuberculosis triosephosphate  ...
1r76:A tqvvqdgkrlgwgqqhdaltlrptsarnfepaalsstesarillflmeieapsdavkqairggva   Structure of a pectate lyase from azospirillum irakense
4k90:B -----------------------------------------------------------------   Extracellular metalloproteinase from aspergillus

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q9S831 -----------------------------------------------------------------   Photosystem I reaction center subunit IV A, chloroplastic  ...
2wsc:E*-----------------------------------------------------------------×3 Improved model of plant photosystem i
2o01:E -----------------------------------------------------------------   The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:E -----------------------------------------------------------------   Improved model of plant photosystem i
1yo9:E -----------------------------------------------------------------   Theoretical model of plant photosystem i
1jb0:E*-----------------------------------------------------------------×3 Crystal structure of photosystem i: a photosynthetic  ...
1qp2:A*-----------------------------------------------------------------×2 Solution structure of photosystem i accessory protein e  ...
1pse:A*-----------------------------------------------------------------×2 The three-dimensional solution structure of psae from the  ...
1gxi:E -----------------------------------------------------------------   Psae sub-unit of the photosystem i of the cyanobacterium  ...
4kt0:E*-----------------------------------------------------------------×2 Crystal structure of a virus like photosystem i from the  ...
2nxo:A -----------------------------------------------------------------   Crystal structure of protein sco4506 from streptomyces  ...
2kr0:A -----------------------------------------------------------------   A proteasome protein
2qdn:A*-----------------------------------------------------------------×3 Crystal structure of mouse gitrl
2q8o:A -----------------------------------------------------------------   Crystal structure of mouse gitr ligand dimer
3gvg:A -----------------------------------------------------------------   Crystal structure of triosephosphate isomerase from  ...
3ta6:A -----------------------------------------------------------------   Structure of mycobacterium tuberculosis triosephosphate isom
3tao:A -----------------------------------------------------------------   Structure of mycobacterium tuberculosis triosephosphate  ...
1r76:A wlntsvirdqgakplwsrfysldgnkpvfgdrdktihddvmgisqerrtgyawyttspqkalsaf   Structure of a pectate lyase from azospirillum irakense
4k90:B -----------------------------------------------------------------   Extracellular metalloproteinase from aspergillus

           5  
           9  
       6789012                                                             Protein name
       ----+--                                                             ------------
Q9S831 -------                                                             Photosystem I reaction center subunit IV A, chloroplastic  ...
2wsc:E*-------                                                          ×3 Improved model of plant photosystem i
2o01:E -------                                                             The structure of a plant photosystem i supercomplex at 3.4  ...
3lw5:E -------                                                             Improved model of plant photosystem i
1yo9:E -------                                                             Theoretical model of plant photosystem i
1jb0:E*-------                                                          ×3 Crystal structure of photosystem i: a photosynthetic  ...
1qp2:A*-------                                                          ×2 Solution structure of photosystem i accessory protein e  ...
1pse:A*-------                                                          ×2 The three-dimensional solution structure of psae from the  ...
1gxi:E -------                                                             Psae sub-unit of the photosystem i of the cyanobacterium  ...
4kt0:E*-------                                                          ×2 Crystal structure of a virus like photosystem i from the  ...
2nxo:A -------                                                             Crystal structure of protein sco4506 from streptomyces  ...
2kr0:A -------                                                             A proteasome protein
2qdn:A*-------                                                          ×3 Crystal structure of mouse gitrl
2q8o:A -------                                                             Crystal structure of mouse gitr ligand dimer
3gvg:A -------                                                             Crystal structure of triosephosphate isomerase from  ...
3ta6:A -------                                                             Structure of mycobacterium tuberculosis triosephosphate isom
3tao:A -------                                                             Structure of mycobacterium tuberculosis triosephosphate  ...
1r76:A tkwekrs                                                             Structure of a pectate lyase from azospirillum irakense
4k90:B -------                                                             Extracellular metalloproteinase from aspergillus

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q9S831. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 143 - - Q9S831 Photosystem I reaction center subunit IV A, chloroplastic OS=Arabidopsis thaliana GN=PSAE1 PE=1 SV=1
2. 418 100.0% 65 65 565.5 1.6e-24 2wsc:E * Improved model of plant photosystem i
3. " " " " " "  = 2wse:E *
Improved model of plant photosystem i
4. " " " " " "  = 2wsf:E *
Improved model of plant photosystem i
5. 400 100.0% 62 62 542.1 3.2e-23 2o01:E The structure of a plant photosystem i supercomplex at 3.4 a resolution
6. 361 84.1% 63 64 490.5 2.4e-20 3lw5:E Improved model of plant photosystem i
7. 358 82.5% 63 64 486.5 4e-20 1yo9:E Theoretical model of plant photosystem i
8. 256 58.8% 68 69 351.5 1.3e-12 1jb0:E * Crystal structure of photosystem i: a photosynthetic reactio and core antenna system from cyanobacteria
9. " " " " " "  = 3pcq:E *
Femtosecond x-ray protein nanocrystallography
10. " " " " " "  = 4fe1:E *
Improving the accuracy of macromolecular structure refinemen resolution
11. 256 62.9% 62 70 351.4 1.4e-12 1qp2:A * Solution structure of photosystem i accessory protein e from cyanobacterium nostoc sp. Strain pcc 8009
12. " " " " " "  = 1qp3:A *
Solution structure of photosystem i accessory protein e from cyanobacterium nostoc sp. Strain pcc 8009
13. 204 52.2% 67 69 282.9 8.8e-09 1pse:A * The three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. Strain pcc 7002: a photosy protein that shows structural homology with sh3 domains
14. " " " " " "  = 1psf:A *
The three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. Strain pcc 7002: a photosy protein that shows structural homology with sh3 domains
15. 183 45.6% 68 73 254.8 3.2e-07 1gxi:E Psae sub-unit of the photosystem i of the cyanobacterium synechocystis sp. Pcc 6803
16. 179 45.5% 66 68 250.0 6e-07 4kt0:E * Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
17. " " " " " "  = 4l6v:E *
Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
18. 104 29.5% 139 272 141.7 0.64 2nxo:A Crystal structure of protein sco4506 from streptomyces coelicolor, pfam duf178
19. 97 28.8% 66 407 124.5 5.8 2kr0:A A proteasome protein
20. 83 35.2% 54 123 119.4 11 2qdn:A * Crystal structure of mouse gitrl
21. " " " " " "  = 3b9i:A *
Crystal structure of mouse gitrl at 2.5 a.
22. " " " " " "  = 3fc0:A *
1.8 a crystal structure of murine gitr ligand dimer expressed in drosophila melanogaster s2 cells
23. 83 35.2% 54 125 119.3 11 2q8o:A Crystal structure of mouse gitr ligand dimer
24. 84 29.3% 82 256 115.8 18 3gvg:A Crystal structure of triosephosphate isomerase from mycobact tuberculosis
25. 84 29.3% 82 255 115.8 18 3ta6:A Structure of mycobacterium tuberculosis triosephosphate isom
26. 84 29.3% 82 256 115.8 18 3tao:A Structure of mycobacterium tuberculosis triosephosphate isom bound to phosphoglycolohydroxamate
27. 87 27.6% 98 384 109.1 42 1r76:A Structure of a pectate lyase from azospirillum irakense
28. 77 29.7% 74 207 108.0 49 4k90:B Extracellular metalloproteinase from aspergillus

Number of sequences: 28

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer