SAS results for PDB entry 2tlx Sequence annotated by structure Key: Sec. struc: Actual   Helix Strand   Motifs:   beta-turn   gamma-turn Residue contacts:   to ligand   to metal Catalytic residues:   (from CSA) Active sites:   (from PDB SITE records) PROSITE patterns: Low   High conservation Click on annotated residues to get source(s) of each annotation.

FASTA alignment for PDB entry 2tlx - coloured by no. of contacts to ligand Below are the FASTA results from a search of the sequence of PDB entry 2tlx against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment. Struct FASTA The search returned 21 unique sequences (including 4 consensus sequences) giving 105 sequence matches in all. The 1 sequences excluded from the alignment is listed at the end.

Modify alignment:		Annotate by: Residue type Secondary structure No. of H-bonds to ligand No. of contacts to ligand No. of contacts to metal ions No. of contacts to nucleic acids SITE residues (from PDB remarks) Residue similarity PROSITE patterns
		Number: by alignment position each sequence separately
		Show secondary structure: Yes No

                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
2tlx:A -----------------------------------------------------------------    Thermolysin (native)
1fj3:A*-----------------------------------------------------------------×58 Thermolysin (50% acetone soaked)
1kei:A*-----------------------------------------------------------------×25 Thermolysin (substrate-free)
1npc:A -----------------------------------------------------------------    The structure of neutral protease from bacillus cereus at 0. ...
1esp:A -----------------------------------------------------------------    Neutral protease mutant e144s
1bqb:A -----------------------------------------------------------------    Aureolysin, staphylococcus aureus metalloproteinase
2vqx:A -----------------------------------------------------------------    Precursor of protealysin, metalloproteinase from serratia  ...
2a4i:A -----------------------------------------------------------------    Homology model of vimelysin
1ezm:A*-----------------------------------------------------------------×3  Three-dimensional structure of the elastase of pseudomonas  ...
1trl:A -----------------------------------------------------------------    Nmr solution structure of thE C-terminal fragment 255-316  ...
3h2s:A ---------------mkiavlgatgragsaivaearrrghevlavvrdpqkaadrlgatvatlvk    Crystal structure of the q03b84 protein from lactobacillus  ...
1ibq:A skgsavttpqnndeeyltpvtvgkstlhldfdtgsadlwvfsdelpsseqtghdlytpsssatkl    Aspergillopepsin from aspergillus phoenicis
2r5v:A -----------------------------------------------------------------    Hydroxymandelate synthase crystal structure
2cdo:A -----------------------------------------------------------------    Structure of agarase carbohydrate binding module in complex  ...
2cdp:A -----------------------------------------------------------------    Structure of a cbm6 in complex with neoagarohexaose
2zl0:A -----------------------------------------------------------------    Crystal structure of h.Pylori clpp
2zl2:A -----------------------------------------------------------------    Crystal structure of h.Pylori clpp in complex with the  ...
3klr:A -----------------------------------------------------------------    Bovine h-protein at 0.88 angstrom resolution
2edg:A -----------------------------------------------------------------    Solution structure of the gcv_h domain from mouse glycine
2zl3:A*-----------------------------------------------------------------×2  Crystal structure of h.Pylori clpp s99a
1qjp:A -------------------------------------------------------apkdntwytg    High resolution structure of the outer membrane protein a  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
2tlx:A -----------------ITGTSTVGVGRGVLGDQKNIN-TTY-S-TYYY-LQDNTR---GDG-IF    Thermolysin (native)
1fj3:A*-----------------ITGTSTVGVGRGVLGDQKNIN-TTY-S-TYYY-LQDNTR---GDG-IF×58 Thermolysin (50% acetone soaked)
1kei:A*-----------------ITGTSTVGVGRGVLGDQKNIN-TTY-S-TYYY-LQDNTR---GNG-IF×25 Thermolysin (substrate-free)
1npc:A -----------------vtgtnkvgtgkgvlgdtksln-ttl-sgssyy-lqdntr---gat-if    The structure of neutral protease from bacillus cereus at 0. ...
1esp:A -----------------vtgtnkvgtgkgvlgdtksln-ttl-sgssyy-lqdntr---gat-if    Neutral protease mutant e144s
1bqb:A --------------------aaatgtgkgvlgdtkdininsi-d-ggfs-ledlth---qgk-ls    Aureolysin, staphylococcus aureus metalloproteinase
2vqx:A ---------------arsvippymlrriiehgslpqrd-cal-h-tlnh-vktstg---gev-ir    Precursor of protealysin, metalloproteinase from serratia  ...
2a4i:A akssgtgpggnlkttryeygsdfpsfsidktgttckle-nds-v-ktvn-lnhgts---gsa-ay    Homology model of vimelysin
1ezm:A*------------------------AEAGGPGGNQKIGK-YTYGS-DYGP-LIVNDRCEMDDGNVI×3  Three-dimensional structure of the elastase of pseudomonas  ...
1trl:A -----------------------------------------------------------------    Nmr solution structure of thE C-terminal fragment 255-316  ...
3h2s:A eplvlteadldsvdavvdalsvpwgsgrgyl------h-ldf-a-thlvsllrnsd---tla-vf    Crystal structure of the q03b84 protein from lactobacillus  ...
1ibq:A sgyswdisygdgssasgdvyrdtvtvg-gvttnkqave-aas-kissef-vqd-ta---ndg-ll    Aspergillopepsin from aspergillus phoenicis
2r5v:A ------------------qnfeidyvemyvenlevaaf-swv-d-kyaf-avagts---rsa-dh    Hydroxymandelate synthase crystal structure
2cdo:A -----------------------------------------------------------------    Structure of agarase carbohydrate binding module in complex  ...
2cdp:A -----------------------------------------------------------------    Structure of a cbm6 in complex with neoagarohexaose
2zl0:A -----------------------------------------------------------------    Crystal structure of h.Pylori clpp
2zl2:A -----------------------------------------------------------------    Crystal structure of h.Pylori clpp in complex with the  ...
3klr:A -----------------------------------------------------------------    Bovine h-protein at 0.88 angstrom resolution
2edg:A -----------------------------------------------------------------    Solution structure of the gcv_h domain from mouse glycine
2zl3:A*-----------------------------------------------------------------×2  Crystal structure of h.Pylori clpp s99a
1qjp:A aklgwsqhenklgagafggyqvnpyvgfemgydwlgrm-pya-y-kaqg-vqltak---lgy-pi    High resolution structure of the outer membrane protein a  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
2tlx:A --------T-YDAKYRT----TLPGSLW-ADADN--QFFA---SYDAPAVDAHY-YAGVTYDYYK    Thermolysin (native)
1fj3:A*--------T-YDAKYRT----TLPGSLW-ADADN--QFFA---SYDAPAVDAHY-YAGVTYDYYK×58 Thermolysin (50% acetone soaked)
1kei:A*--------T-YDAKYRT----TLPGSLW-ADADN--QFFA---SYDAPAVDAHY-YAGVTYDYYK×25 Thermolysin (substrate-free)
1npc:A --------t-ydaknrs----tlpgtlw-adadn--vfna---aydaaavdahy-yagktydyyk    The structure of neutral protease from bacillus cereus at 0. ...
1esp:A --------t-ydaknrs----tlpgtlw-adadn--vfna---aydaaavdahy-yagktydyyk    Neutral protease mutant e144s
1bqb:A --------a-ynfndqt----g-qatli-tnede--nfvk---ddqragvdany-yakqtydyyk    Aureolysin, staphylococcus aureus metalloproteinase
2vqx:A --------diydaenst----qlpgk----qvrn--egqa---snhdvavdeaydylgvtydffw    Precursor of protealysin, metalloproteinase from serratia  ...
2a4i:A --------s-yncadgt----ny--------tdh--kyin---gaysplndahy-fgnvvfdmyk    Homology model of vimelysin
1ezm:A*--------T-VDMNSSTDDSKTTPFRFA-CPTNTYKQVNG---AY-SPLNDAHF-FGGVVFKLYR×3  Three-dimensional structure of the elastase of pseudomonas  ...
1trl:A -----------------------------------------------------------------    Nmr solution structure of thE C-terminal fragment 255-316  ...
3h2s:A --------i-lgsa-sl----ampg------adh--pmil---dfpesaasqpw-ydgalyqyye    Crystal structure of the q03b84 protein from lactobacillus  ...
1ibq:A glafssint-vqpkaqt----tffdtvk-sqlds--plfavqlkhdapgv----------ydf--    Aspergillopepsin from aspergillus phoenicis
2r5v:A --------r-sialrqg----qvtlvlt-eptsd--rhpa---aaylqthgdgv-adiamatsdv    Hydroxymandelate synthase crystal structure
2cdo:A -----------------------------------------------------------------    Structure of agarase carbohydrate binding module in complex  ...
2cdp:A -----------------------------------------------------------------    Structure of a cbm6 in complex with neoagarohexaose
2zl0:A -----------------------------------------------------------------    Crystal structure of h.Pylori clpp
2zl2:A -----------------------------------------------------------------    Crystal structure of h.Pylori clpp in complex with the  ...
3klr:A -----------------------------------------------------------------    Bovine h-protein at 0.88 angstrom resolution
2edg:A -----------------------------------------------------------------    Solution structure of the gcv_h domain from mouse glycine
2zl3:A*-----------------------------------------------------------------×2  Crystal structure of h.Pylori clpp s99a
1qjp:A --------t-ddldiyt----rlggmvwradtys--nvyg---knhdtgvspvf-aggveyaitp    High resolution structure of the outer membrane protein a  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
2tlx:A NVHNR--LSYDGNNAAIRSSVHYSQ-----GYNNAFWNG-----SEMVYGDGDGQTF-IP-LSGG    Thermolysin (native)
1fj3:A*NVHNR--LSYDGNNAAIRSSVHYSQ-----GYNNAFWNG-----SEMVYGDGDGQTF-IP-LSGG×58 Thermolysin (50% acetone soaked)
1kei:A*NVHNR--LSYDGNNAAIRSSVHYSQ-----GYNNAFWNG-----SQMVYGDGDGQTF-IP-LSGG×25 Thermolysin (substrate-free)
1npc:A atfnr--nsindagaplkstvhygs-----nynnafwng-----sqmvygdgdgvtf-ts-lsgg    The structure of neutral protease from bacillus cereus at 0. ...
1esp:A atfnr--nsindagaplkstvhygs-----nynnafwng-----sqmvygdgdgvtf-ts-lsgg    Neutral protease mutant e144s
1bqb:A ntfgr--esydnhgspivslthvnhyggqdnrnnaawig-----dkmiygdgdgrtf-tn-lsga    Aureolysin, staphylococcus aureus metalloproteinase
2vqx:A qafkr--nsldnqglpltgsvhygk-----eyqnafwng-----qqmvfgdgdgeif-nr-ftia    Precursor of protealysin, metalloproteinase from serratia  ...
2a4i:A ewmntspltfq-----ltmrvhyss-----nyenafwng-----ssmtfgdg-gstf-yp-lvd-    Homology model of vimelysin
1ezm:A*DWFGT--SPLTHK---LYMKVHYGR-----SVENAYWDG-----TAMLFGDG-ATMF-YP-LVS-×3  Three-dimensional structure of the elastase of pseudomonas  ...
1trl:A -----------------------------------------------------------------    Nmr solution structure of thE C-terminal fragment 255-316  ...
3h2s:A yqflq--mnanvnwigispseafps-----gpatsyvag-----kdtllvgedgqsh-it-tgnm    Crystal structure of the q03b84 protein from lactobacillus  ...
1ibq:A gyidd--skytgs--itytdadssq-----gy----wgf-----stdgysigdgsss-----ssg    Aspergillopepsin from aspergillus phoenicis
2r5v:A aaaye--aavragaeavrapgqhsa-----avttatiggfgdvvhtliqrdgtsael-ppgftgs    Hydroxymandelate synthase crystal structure
2cdo:A --------------------stasm-----aveaenfna-----vggtfsdgqaqpvsvy-tvng    Structure of agarase carbohydrate binding module in complex  ...
2cdp:A --------------------stasi-----aveaenfna-----vggtfsdgqaqpvsvy-tvng    Structure of a cbm6 in complex with neoagarohexaose
2zl0:A -----------------------------------------------------------------    Crystal structure of h.Pylori clpp
2zl2:A -----------------------------------------------------------------    Crystal structure of h.Pylori clpp in complex with the  ...
3klr:A -----------------------------------------------------------------    Bovine h-protein at 0.88 angstrom resolution
2edg:A -----------------------------------------------------------------    Solution structure of the gcv_h domain from mouse glycine
2zl3:A*-----------------------------------------------------------------×2  Crystal structure of h.Pylori clpp s99a
1qjp:A eiatr--leyqwtngmlslgvsyrf-----g----------------------------------    High resolution structure of the outer membrane protein a  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
2tlx:A IDVVAH---ELTH--AVT--DYTAGLIYQNESGAIN--EAISDIFGTLV-EFYANKNPD---WEI    Thermolysin (native)
1fj3:A*IDVVAH---ELTH--AVT--DYTAGLIYQNESGAIN--EAISDIFGTLV-EFYANKNPD---WEI×58 Thermolysin (50% acetone soaked)
1kei:A*IDVVAH---ELTH--AVT--DYTAGLIYQNESGAIN--EAISDIFGTLV-EFYANKNPD---WEI×25 Thermolysin (substrate-free)
1npc:A idvigh---elth--avt--enssnliyqnesgaln--eaisdifgtlv-efydnrnpd---wei    The structure of neutral protease from bacillus cereus at 0. ...
1esp:A idvigh---slth--avt--enssnliyqnesgaln--eaisdifgtlv-efydnrnpd---wei    Neutral protease mutant e144s
1bqb:A ndvvah---eith--gvt--qqtanleykdqsgaln--esfsdvfgyfv-d-----ded---flm    Aureolysin, staphylococcus aureus metalloproteinase
2vqx:A idvvgh---alah--gvt--eseagliyfqqagaln--eslsdvfgslvkqfhlkqtadkadwli    Precursor of protealysin, metalloproteinase from serratia  ...
2a4i:A invsah---evsh--gft--eqnsglvyqnmsggin--eafsdiageaa-eyylrgnvd---wvv    Homology model of vimelysin
1ezm:A*LDVAAH---EVSH--GFT--EQNSGLIYRGQSGGMN--EAFSDMAGEAA-EFYMRGKND---FLI×3  Three-dimensional structure of the elastase of pseudomonas  ...
1trl:A -----------------------------------------------------------------    Nmr solution structure of thE C-terminal fragment 255-316  ...
3h2s:A alaild---qlehptair--drivvrdad------------------------------------    Crystal structure of the q03b84 protein from lactobacillus  ...
1ibq:A fsaiad---tgtt--lillddeivsayyeqvsgaqesyeaggyvfscst-dl-----pd---ftv    Aspergillopepsin from aspergillus phoenicis
2r5v:A mdvtnhgkgdvdl--lgi--dhfaiclnagdlgptv--eyyeralgfrq-ifdehivvg---aqa    Hydroxymandelate synthase crystal structure
2cdo:A ntainy---vnqg--dya--dytiavaqagnytisy--qagsgvtggsi-efmvnengs---was    Structure of agarase carbohydrate binding module in complex  ...
2cdp:A ntainy---vnqg--dya--dytiavaqagnytisy--qagsgvtggsi-eflvnengs---was    Structure of a cbm6 in complex with neoagarohexaose
2zl0:A ---------------diy--srllkdrivllsgein--dsvassivaql-lfleaedpe---kdi    Crystal structure of h.Pylori clpp
2zl2:A ---------------diy--srllkdrivllsgein--dsvassivaql-lfleaedpe---kdi    Crystal structure of h.Pylori clpp in complex with the  ...
3klr:A -----------------------------------------------------------------    Bovine h-protein at 0.88 angstrom resolution
2edg:A -----------------------------------------------------------------    Solution structure of the gcv_h domain from mouse glycine
2zl3:A*---------------diy--srllkdrivllsgein--dsvassivaql-lfleaedpe---kdi×2  Crystal structure of h.Pylori clpp s99a
1qjp:A -----------------------------------------------------------------    High resolution structure of the outer membrane protein a  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
2tlx:A GEDVYTPGISGDSLRSMS-------DPAKYGDP-DHYS-KRYTGTQ-DNGGVHI--N--SGIINK    Thermolysin (native)
1fj3:A*GEDVYTPGISGDSLRSMS-------DPAKYGDP-DHYS-KRYTGTQ-DNGGVHI--N--SGIINK×58 Thermolysin (50% acetone soaked)
1kei:A*GEDVYTPGISGDSLRSMS-------DPAKYGDP-DHYS-KRYTGTQ-DNGGVHI--N--SGIINK×25 Thermolysin (substrate-free)
1npc:A gediytpgkagdalrsms-------dptkygdp-dhys-krytgss-dnggvht--n--sgiink    The structure of neutral protease from bacillus cereus at 0. ...
1esp:A gediytpgkagdalrsms-------dptkygdp-dhys-krytgss-dnggvht--n--sgiink    Neutral protease mutant e144s
1bqb:A gedvytpgkegdalrsms-------npeqfgqp-shmk-dyvytek-dnggvht--n--sgipnk    Aureolysin, staphylococcus aureus metalloproteinase
2vqx:A gegllakgingkglrsmsapgtayddpllgkdp-qpasmkdyiqtkednggvhl--n--sgipnr    Precursor of protealysin, metalloproteinase from serratia  ...
2a4i:A gsdifk---segglryfd-------qpskdgrsidhas-qyydgln-----vhl--s--sgvynr    Homology model of vimelysin
1ezm:A*GYDI-KKG-SG-ALRYMD-------QPSRDGRSIDNAS-QYYNGID-----VHH--S--SGVYNR×3  Three-dimensional structure of the elastase of pseudomonas  ...
1trl:A -----------------------------------------------------------------    Nmr solution structure of thE C-terminal fragment 255-316  ...
3h2s:A -----------------------------------------------------------------    Crystal structure of the q03b84 protein from lactobacillus  ...
1ibq:A vigdykavvpgkyinya---------pvstgs-----s-tcyggiq-snsglgl--silgdvflk    Aspergillopepsin from aspergillus phoenicis
2r5v:A mnstvvqsasgavtltli-------epdrnadp-gqid-eflkdhq-gagvqhiafn--sndavr    Hydroxymandelate synthase crystal structure
2cdo:A ktvtavpnqgwdnfqpln-------ggsvylsa-gthq-vrlhgag-snnwqwn--l--dkftls    Structure of agarase carbohydrate binding module in complex  ...
2cdp:A ktvtavpnqgwdnfqpln-------ggsvylsa-gthq-vrlhgag-snnwqwn--l--dkftls    Structure of a cbm6 in complex with neoagarohexaose
2zl0:A glyinspggvitsglsiy-------dtmnfirp-dvst-icigqaa-smgafll--s--cgakgk    Crystal structure of h.Pylori clpp
2zl2:A glyinspggvitsglsiy-------dtmnfirp-dvst-icigqaa-smgafll--s--cgakgk    Crystal structure of h.Pylori clpp in complex with the  ...
3klr:A -------------------------------------------------------------svrk    Bovine h-protein at 0.88 angstrom resolution
2edg:A ----------------------------------------------------gs--s--gssgrk    Solution structure of the gcv_h domain from mouse glycine
2zl3:A*glyinspggvitsglsiy-------dtmnfirp-dvst-icigqaa-amgafll--s--cgakgk×2  Crystal structure of h.Pylori clpp s99a
1qjp:A -----------------------------------------------------------------    High resolution structure of the outer membrane protein a  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
2tlx:A ------AAYLI--SQ--GGTHYGVSVVGIG---RDKLGKIFYRALTQYLTPT-SNFSQLRA-AAV    Thermolysin (native)
1fj3:A*------AAYLI--SQ--GGTHYGVSVVGIG---RDKLGKIFYRALTQYLTPT-SNFSQLRA-AAV×58 Thermolysin (50% acetone soaked)
1kei:A*------AAYLI--SQ--GGTHYGVSVVGIG---RDKLGKIFYRALTQYLTPT-SNFSQLRA-AAV×25 Thermolysin (substrate-free)
1npc:A ------qayll--an--ggthygvtvtgig---kdklgaiyyrantqyftqs-ttfsqara-gav    The structure of neutral protease from bacillus cereus at 0. ...
1esp:A ------qayll--an--ggthygvtvtgig---kdklgaiyyrantqyftqs-ttfsqara-gav    Neutral protease mutant e144s
1bqb:A ------aaynv--iq--a----------ig---kskseqiyyralteyltsn-snfkdlkd-aly    Aureolysin, staphylococcus aureus metalloproteinase
2vqx:A ------afyl-------aatalg----gya---wekagyiwydtlcdkalpqdadfatfar-ttv    Precursor of protealysin, metalloproteinase from serratia  ...
2a4i:A ------afyll--an--ks--------gwd---vrkgfeiftvanqlywtan-stfdagac-gva    Homology model of vimelysin
1ezm:A*------AFYLL--AN--SP--------GWD---TRKAFEVFVDANRYYWTAT-SNYNSGAC-GVI×3  Three-dimensional structure of the elastase of pseudomonas  ...
1trl:A -------------------------vvgig---rdklgkifyraltqyltpt-snfsqlra-aav    Nmr solution structure of thE C-terminal fragment 255-316  ...
3h2s:A -----------------------------------------------------------------    Crystal structure of the q03b84 protein from lactobacillus  ...
1ibq:A ------sqyvvfnse--gpklgfaaqa--------------------------------------    Aspergillopepsin from aspergillus phoenicis
2r5v:A ------avkal--se--rgvef-lktpgay---ydllge---ritlq----t-hslddlra-tnv    Hydroxymandelate synthase crystal structure
2cdo:A ------n----------------------------------------------------------    Structure of agarase carbohydrate binding module in complex  ...
2cdp:A ------n----------------------------------------------------------    Structure of a cbm6 in complex with neoagarohexaose
2zl0:A rfslphsrimi--hqplggaqgqasdieii---sneilrl--kglmnsilaq-nsgqsleq-iak    Crystal structure of h.Pylori clpp
2zl2:A rfslphsrimi--hqplggaqgqasdieii---sneilrl--kglmnsilaq-nsgqsleq-iak    Crystal structure of h.Pylori clpp in complex with the  ...
3klr:A ------ftekh--ew--vttengvgtvgisnfaqealgdvvycslpevgtkl-nkqeefgalesv    Bovine h-protein at 0.88 angstrom resolution
2edg:A ------ftekh--ew--itteegigtvgisnfaqealgdvvycslpevgtkl-kkqeefgalesv    Solution structure of the gcv_h domain from mouse glycine
2zl3:A*rfslphsrimi--hqplggaqgqasdieii---sneilrl--kglmnsilaq-nsgqsleq-iak×2  Crystal structure of h.Pylori clpp s99a
1qjp:A -----------------------------------------------------------------    High resolution structure of the outer membrane protein a  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
2tlx:A QSATDLYGSTSQEVASVKQAFDAVGVK--------------------------------------    Thermolysin (native)
1fj3:A*QSATDLYGSTSQEVASVKQAFDAVGVK--------------------------------------×58 Thermolysin (50% acetone soaked)
1kei:A*QSATDLYGSTSQEVASVKQAFDAVGVK--------------------------------------×25 Thermolysin (substrate-free)
1npc:A qaaadlygansaevaavkqsfsavgvn--------------------------------------    The structure of neutral protease from bacillus cereus at 0. ...
1esp:A qaaadlygansaevaavkqsfsavgvn--------------------------------------    Neutral protease mutant e144s
1bqb:A qaakdly--eqqtaeqvyeawnevgve--------------------------------------    Aureolysin, staphylococcus aureus metalloproteinase
2vqx:A khaeqrfds--kvaqkvqqawhqvgva--------------------------------------    Precursor of protealysin, metalloproteinase from serratia  ...
2a4i:A kaaadm-gyv---vadvedafntvgvngs------------------------------------    Homology model of vimelysin
1ezm:A*RSAQN----RNYSAADVTRAFSTVGVTCP------------------------------------×3  Three-dimensional structure of the elastase of pseudomonas  ...
1trl:A qsatdlygstsqevasvkqafdavgvk--------------------------------------    Nmr solution structure of thE C-terminal fragment 255-316  ...
3h2s:A -----------------------------------------------------------------    Crystal structure of the q03b84 protein from lactobacillus  ...
1ibq:A -----------------------------------------------------------------    Aspergillopepsin from aspergillus phoenicis
2r5v:A ladedhggqlfqiftasthprhtiffevierqgagtfgssnikalyeavelertg----------    Hydroxymandelate synthase crystal structure
2cdo:A -----------------------------------------------------------------    Structure of agarase carbohydrate binding module in complex  ...
2cdp:A -----------------------------------------------------------------    Structure of a cbm6 in complex with neoagarohexaose
2zl0:A dtdrdfymsakeakeyglidkvlq-----------------------------------------    Crystal structure of h.Pylori clpp
2zl2:A dtdrdfymsakeakeyglidkvlqk----------------------------------------    Crystal structure of h.Pylori clpp in complex with the  ...
3klr:A kaaselysplsgevteinkalaenpglvnkscyedgwlikmtfsnpseldelmseeayekyiksi    Bovine h-protein at 0.88 angstrom resolution
2edg:A kaaselysplsgevtevnealaenpglvnkscyedgwlikmtlsdpseldelmseeayekyvksi    Solution structure of the gcv_h domain from mouse glycine
2zl3:A*dtdrdfymsakeakeyglidkvlq-----------------------------------------×2  Crystal structure of h.Pylori clpp s99a
1qjp:A -----------------------------------------------------------------    High resolution structure of the outer membrane protein a  ...

         
         
       12                                                                   Protein name
       --                                                                   ------------
2tlx:A --                                                                   Thermolysin (native)
1fj3:A*--                                                               ×58 Thermolysin (50% acetone soaked)
1kei:A*--                                                               ×25 Thermolysin (substrate-free)
1npc:A --                                                                   The structure of neutral protease from bacillus cereus at 0. ...
1esp:A --                                                                   Neutral protease mutant e144s
1bqb:A --                                                                   Aureolysin, staphylococcus aureus metalloproteinase
2vqx:A --                                                                   Precursor of protealysin, metalloproteinase from serratia  ...
2a4i:A --                                                                   Homology model of vimelysin
1ezm:A*--                                                               ×3  Three-dimensional structure of the elastase of pseudomonas  ...
1trl:A --                                                                   Nmr solution structure of thE C-terminal fragment 255-316  ...
3h2s:A --                                                                   Crystal structure of the q03b84 protein from lactobacillus  ...
1ibq:A --                                                                   Aspergillopepsin from aspergillus phoenicis
2r5v:A --                                                                   Hydroxymandelate synthase crystal structure
2cdo:A --                                                                   Structure of agarase carbohydrate binding module in complex  ...
2cdp:A --                                                                   Structure of a cbm6 in complex with neoagarohexaose
2zl0:A --                                                                   Crystal structure of h.Pylori clpp
2zl2:A --                                                                   Crystal structure of h.Pylori clpp in complex with the  ...
3klr:A ee                                                                   Bovine h-protein at 0.88 angstrom resolution
2edg:A ee                                                                   Solution structure of the gcv_h domain from mouse glycine
2zl3:A*--                                                               ×2  Crystal structure of h.Pylori clpp s99a
1qjp:A --                                                                   High resolution structure of the outer membrane protein a  ...

Residue colours:

black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Aligned sequences

		Smith- Waterman score		%-tage identity		a.a. overlap		Seq len		z-score		E- value				PDB code		Protein name
1.		-		-		-		316		-		-				2tlx:A		Thermolysin (native)
2.		2094		100.0%		316		316		2420.6		4.8e-128				1fj3:A *		Thermolysin (50% acetone soaked)
3.		"		"		"		"		"		"				= 1fjo:A *		Thermolysin (60% acetone soaked crystals)
4.		"		"		"		"		"		"				= 1fjq:A *		Thermolysin (70% acetone soaked crystals)
5.		"		"		"		"		"		"				= 1fjt:A *		Thermolysin (50% acetonitrile soaked crystals)
6.		"		"		"		"		"		"				= 1fju:A *		Thermolysin (80% acetonitrile soaked crystals)
7.		"		"		"		"		"		"				= 1fjv:A *		Thermolysin (60% acetonitrile soaked crystals)
8.		"		"		"		"		"		"				= 1fjw:A *		Thermolysin (50 mm phenol soaked)
9.		"		"		"		"		"		"				= 1gxw:A *		The 2.2 a resolution structure of thermolysin crystallized in presence of potassium thiocyanate
10.		"		"		"		"		"		"				= 1hyt:A *		Re-determination and refinement of the complex of benzylsuccinic acid with thermolysin and its relation to the complex with carboxypeptidase a
11.		"		"		"		"		"		"				= 1l3f:E *		Thermolysin in the absence of substrate has an open conformation
12.		"		"		"		"		"		"				= 1lna:E *		A structural analysis of metal substitutions in thermolysin
13.		"		"		"		"		"		"				= 1lnb:E *		A structural analysis of metal substitutions in thermolysin
14.		"		"		"		"		"		"				= 1lnc:E *		A structural analysis of metal substitutions in thermolysin
15.		"		"		"		"		"		"				= 1lnd:E *		A structural analysis of metal substitutions in thermolysin
16.		"		"		"		"		"		"				= 1lne:E *		A structural analysis of metal substitutions in thermolysin
17.		"		"		"		"		"		"				= 1lnf:E *		A structural analysis of metal substitutions in thermolysin
18.		"		"		"		"		"		"				= 1no0:A *		Thermolysin with an alpha-amino phosphinic inhibitor
19.		"		"		"		"		"		"				= 1os0:A *		Thermolysin with an alpha-amino phosphinic inhibitor
20.		"		"		"		"		"		"				= 1pe5:A *		Thermolysin with tricyclic inhibitor
21.		"		"		"		"		"		"				= 1pe7:A *		Thermolysin with bicyclic inhibitor
22.		"		"		"		"		"		"				= 1pe8:A *		Thermolysin with monocyclic inhibitor
23.		"		"		"		"		"		"				= 1qf0:A *		Thermolysin (E.C.3.4.24.27) complexed with (2-sulphanyl-3- phenylpropanoyl)-phe-tyr. Parameters for zn-bidentation of mercaptoacyldipeptides in metalloendopeptidase
24.		"		"		"		"		"		"				= 1qf1:A *		Thermolysin (E.C.3.4.24.27) complexed with (2- sulphanylheptanoyl)-phe-ala. Parameters for zn-bidentation of mercaptoacyldipeptides in metalloendopeptidase
25.		"		"		"		"		"		"				= 1qf2:A *		Thermolysin (E.C.3.4.24.27) complexed with (2-sulphanyl-3- phenylpropanoyl)-gly-(5-phenylproline). Parameters for zn- monodentation of mercaptoacyldipeptides in metalloendopeptidase
26.		"		"		"		"		"		"				= 1thl:A *		Thermolysin complexed with a novel glutaramide derivative, n-(1-(2(r,s)-carboxy-4-phenylbutyl) cyclopentylcarbonyl)- (s)-tryptophan
27.		"		"		"		"		"		"				= 1tli:A *		Thermolysin (2% isopropanol soaked crystals)
28.		"		"		"		"		"		"				= 1tln *		Hydrolase (neutral metallo-proteinase)
29.		"		"		"		"		"		"				= 1tlp:E *		Crystallographic structural analysis of phosphoramidates as inhibitors and transition-state analogs of thermolysin
30.		"		"		"		"		"		"				= 1tlx:A *		Thermolysin (native)
31.		"		"		"		"		"		"				= 1tmn:E *		Binding of n-carboxymethyl dipepetide inhibitors to thermolysin determined by x-ray crystallography. A novel class of transition-state analogues for zinc peptidases
32.		"		"		"		"		"		"				= 1z9g:E *		Crystal structure analysis of thermolysin complexed with the inhibitor (r)-retro-thiorphan
33.		"		"		"		"		"		"				= 1zdp:E *		Crystal structure analysis of thermolysin complexed with the inhibitor (s)-thiorphan
34.		"		"		"		"		"		"				= 2a7g:E *		On the routine use of soft x-rays in macromolecular crystallography, part iii- the optimal data collection wavelength
35.		"		"		"		"		"		"				= 2g4z:A *		Anomalous substructure of thermolysin
36.		"		"		"		"		"		"				= 2tli:A *		Thermolysin (5% isopropanol soaked crystals)
37.		"		"		"		"		"		"				= 2tln *		Hydrolase (neutral metallo-proteinase)
38.		"		"		"		"		"		"				= 2tmn:E *		Crystallographic structural analysis of phosphoramidates as inhibitors and transition-state analogs of thermolysin
39.		"		"		"		"		"		"				= 3eim:A *		Metal exchange in thermolysin
40.		"		"		"		"		"		"				= 3f28:A *		Thermolysin inhibition
41.		"		"		"		"		"		"				= 3f2p:A *		Thermolysin inhibition
42.		"		"		"		"		"		"				= 3fcq:A *		Thermolysin inhibition
43.		"		"		"		"		"		"				= 3for:A *		Thermolysin complexed with bnpa (2-benzyl-3-nitro propanoic acid amide)
44.		"		"		"		"		"		"				= 3tli:A *		Thermolysin (10% isopropanol soaked crystals)
45.		"		"		"		"		"		"				= 3tln *		Hydrolase (metalloproteinase)
46.		"		"		"		"		"		"				= 3tmn:E *		The binding of l-valyl-l-tryptophan to crystalline thermolysin illustrates the mode of interaction of a product of peptide hydrolysis
47.		"		"		"		"		"		"				= 4tli:A *		Thermolysin (25% isopropanol soaked crystals)
48.		"		"		"		"		"		"				= 4tln:A *		Binding of hydroxamic acid inhibitors to crystalline thermolysin suggests a pentacoordinate zinc intermediate in catalysis
49.		"		"		"		"		"		"				= 4tmn:E *		Slow-and fast-binding inhibitors of thermolysin display different modes of binding. Crystallographic analysis of extended phosphonamidate transition-state analogues
50.		"		"		"		"		"		"				= 5tli:A *		Thermolysin (60% isopropanol soaked crystals)
51.		"		"		"		"		"		"				= 5tln:A *		Binding of hydroxamic acid inhibitors to crystalline thermolysin suggests a pentacoordinate zinc intermediate in catalysis
52.		"		"		"		"		"		"				= 5tmn:E *		Slow-and fast-binding inhibitors of thermolysin display different modes of binding. Crystallographic analysis of extended phosphonamidate transition-state analogues
53.		"		"		"		"		"		"				= 6tli:A *		Thermolysin (60% isopropanol soaked crystals)
54.		"		"		"		"		"		"				= 6tln *		Hydrolase (metalloproteinase)
55.		"		"		"		"		"		"				= 6tmn:E *		Structures of two thermolysin-inhibitor complexes that differ by a single hydrogen bond
56.		"		"		"		"		"		"				= 7tli:A *		Thermolysin (90% isopropanol soaked crystals)
57.		"		"		"		"		"		"				= 7tln:A *		Structural analysis of the inhibition of thermolysin by an active-site-directed irreversible inhibitor
58.		"		"		"		"		"		"				= 8tli:A *		Thermolysin (100% isopropanol soaked crystals)
59.		"		"		"		"		"		"				= 8tln:E *		Structural comparison suggests that thermolysin and related neutral proteases undergo hinge-bending motion during catalysis
60.		2084		99.4%		316		316		2409.0		2.1e-127				= 1kei:A *		Thermolysin (substrate-free)
61.		"		"		"		"		"		"				= 1kjo:A *		Thermolysin complexed with z-l-threonine (benzyloxycarbonyl- l-threonine)
62.		"		"		"		"		"		"				= 1kjp:A *		Thermolysin complexed with z-l-glutamic acid (benzyloxycarbonyl-l-glutamic acid)
63.		"		"		"		"		"		"				= 1kkk:A *		Thermolysin complexed with z-l-aspartic acid (benzyloxycarbonyl-l-aspartic acid)
64.		"		"		"		"		"		"				= 1kl6:A *		Thermolysin complexed with z-l-alanine (benzyloxycarbonyl-l- alanine)
65.		"		"		"		"		"		"				= 1kr6:A *		Thermolysin complexed with z-d-glutamic acid (benzyloxycarbonyl-d-glutamic acid)
66.		"		"		"		"		"		"				= 1kro:A *		Thermolysin complexed with z-d-threonine (benzyloxycarbonyl- d-threonine)
67.		"		"		"		"		"		"				= 1ks7:A *		Thermolysin complexed with z-d-aspartic acid (benzyloxycarbonyl-d-aspartic acid)
68.		"		"		"		"		"		"				= 1kto:A *		Thermolysin complexed with z-d-alanine (benzyloxycarbonyl-d- alanine)
69.		"		"		"		"		"		"				= 1y3g:E *		Crystal structure of a silanediol protease inhibitor bound to thermolysin
70.		"		"		"		"		"		"				= 2whz:A *		Dipeptide inhibitors of thermolysin
71.		"		"		"		"		"		"				= 2wi0:A *		Dipeptide inhibitors of thermolysin
72.		"		"		"		"		"		"				= 3dnz:A *		Thermolysin by lb nanotemplate method before high x-ray dose on esrf id14-2 beamline
73.		"		"		"		"		"		"				= 3do0:A *		Thermolysin by classical hanging drop method after high x- ray dose on esrf id14-2 beamline
74.		"		"		"		"		"		"				= 3do1:A *		Thermolysin by classical hanging drop method before high x- ray dose on esrf id14-2 beamline
75.		"		"		"		"		"		"				= 3do2:A *		Thermolysin by lb nanotemplate method after high x-ray dose on esrf id14-2 beamline
76.		"		"		"		"		"		"				= 3fb0:A *		Metal exchange in thermolysin
77.		"		"		"		"		"		"				= 3fbo:A *		Metal exchange in thermolysin
78.		"		"		"		"		"		"				= 3fgd:A *		Drugscore fp: thermoylsin in complex with fragment.
79.		"		"		"		"		"		"				= 3flf:A *		Thermolysin inhibition
80.		"		"		"		"		"		"				= 3fv4:A *		Thermolysin inhibition
81.		"		"		"		"		"		"				= 3fvp:A *		Thermolysin inhibition
82.		"		"		"		"		"		"				= 3fwd:A *		Thermolysin inhibition
83.		"		"		"		"		"		"				= 3fxp:A *		Thermolysin inhibition
84.		"		"		"		"		"		"				= 3fxs:A *		Metal exchange in thermolysin
85.		1575		73.1%		316		317		1821.3		1.1e-94				= 1npc:A		The structure of neutral protease from bacillus cereus at 0.2-nm resolution
86.		1568		72.8%		316		317		1813.2		3.2e-94				= 1esp:A		Neutral protease mutant e144s
87.		824		45.0%		318		301		806.8		3.7e-38				= 1bqb:A		Aureolysin, staphylococcus aureus metalloproteinase
88.		613		40.8%		306		322		620.4		8.9e-28				= 2vqx:A		Precursor of protealysin, metalloproteinase from serratia proteamaculans.
89.		519		36.7%		289		305		556.2		3.4e-24				= 2a4i:A		Homology model of vimelysin
90.		435		33.2%		316		298		454.8		1.5e-18				= 1ezm:A *		Three-dimensional structure of the elastase of pseudomonas aeruginosa at 1.5 angstroms resolution
91.		"		"		"		"		"		"				= 1u4g:A *		Elastase of pseudomonas aeruginosa with an inhibitor
92.		"		"		"		"		"		"				= 3dbk:A *		Pseudomonas aeruginosa elastase with phosphoramidon
93.		380		100.0%		62		62		454.6		1.5e-18				= 1trl:A		Nmr solution structure of thE C-terminal fragment 255-316 of thermolysin: a dimer formed by subunits having the native structure
94.		103		21.9%		146		216		119.0		7.5				= 3h2s:A		Crystal structure of the q03b84 protein from lactobacillus casei. Northeast structural genomics consortium target lcr19.
95.		115		24.4%		262		325		118.1		8.5				= 1ibq:A		Aspergillopepsin from aspergillus phoenicis
96.		100		21.5%		214		346		113.0		16				= 2r5v:A		Hydroxymandelate synthase crystal structure
97.		89		19.6%		107		138		112.2		18				= 2cdo:A		Structure of agarase carbohydrate binding module in complex with neoagarohexaose
98.		88		19.6%		107		138		111.1		21				= 2cdp:A		Structure of a cbm6 in complex with neoagarohexaose
99.		89		20.1%		149		173		110.4		23				= 2zl0:A		Crystal structure of h.Pylori clpp
100.		89		20.1%		149		174		110.4		23				= 2zl2:A		Crystal structure of h.Pylori clpp in complex with the peptide nvlgftq
101.		86		30.3%		66		125		109.6		25				= 3klr:A		Bovine h-protein at 0.88 angstrom resolution
102.		85		30.3%		66		130		108.1		31				= 2edg:A		Solution structure of the gcv_h domain from mouse glycine
103.		87		20.1%		149		173		108.1		31				= 2zl3:A *		Crystal structure of h.Pylori clpp s99a
104.		"		"		"		"		"		"				= 2zl4:A *		Crystal structure of h.Pylori clpp s99a in complex with the peptide aaaa
105.		83		27.1%		70		137		105.4		44				= 1qjp:A		High resolution structure of the outer membrane protein a (ompa) transmembrane domain

Number of sequences: 105

Excluded sequences

		Smith- Waterman score		%-tage identity		a.a. overlap		Seq len		z-score		E- value				PDB code		Protein name
1.		84		26.6%		94		168		104.9		46				= 2jwy:A		Solution nmr structure of uncharacterized lipoprotein yaji from escherichia coli. Northeast structural genomics target er540

Number of sequences: 1

Select or deselect any sequence by clicking its checkbox. Selection shortcuts : select all/none invert selection Then click to effect selection changes.