spacer
spacer

SAS results for UniProt accession no. P45148

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand   to metal
Catalytic residues:   (from CSA)
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P45148 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P45148 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 49 unique sequences (including 5 consensus sequences) giving 57 sequence matches in all. The 29 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P45148 ------------------------mdkikqlfannyswaqrmkeenstyfkeladhqtphylwig   Carbonic anhydrase 2 OS=Haemophilus influenzae (strain ATCC  ...
2a8c:A*------------------------MDKIKQLFANNYSWAQRMKEENSTYFKELADHQTPHYLWIG×2 Haemophilus influenzae beta-carbonic anhydrase
3mf3:A -------------------------DKIKQLFANNYSWAQRMKEENSTYFKELADHQTPHYLWIG   Cobalt(ii)-substituted haemophilus influenzae b-carbonic anh
3e28:A ------------------------MDKIKQLFANNYSWAQRMKEENSTY------HQTPHYLWIG   H. Influenzae beta-carbonic anhydrase, variant y181f
3e2a:A ------------------------MDKIKQLFANNYSWAQRMK------------HQTPHYLWIG   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e3g:A ------------------------MDKIKQLFANNYSWAQRM--------------QTPHYLWIA   H. Influenzae beta-carbonic anhydrase, variant g41a
3e28:C ------------------------MDKIKQLFANNYSWAQRM---------------TPHYLWIG   H. Influenzae beta-carbonic anhydrase, variant y181f
3e3i:A ------------------------MDKIKQLFANNYSWAQRMKEE------------TPHYLWIA   H. Influenzae beta-carbonic anhydrase, variant g41a with  ...
3e2w:A ------------------------MDKIKQLFANNYSWAQRMKEEN----------QTPHYLWIG   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e24:A ----------------------------------------------------------PHYLFIG   H. Influenzae beta-carbonic anhydrase, variant w39f
3e31:A --------------------------------------------------------qtphylwig   H. Influenzae beta-carbonic anhydrase, variant v47a
3e2x:A*---------------------------------------------------------TPHYLWIG×2 H. Influenzae beta-carbonic anhydrase, variant v47a
3e1v:A*---------------------------------------------------------tphylwig×2 H. Influenzae beta-carbonic anhydrase, variant d44n
1i6o:A --------------------------didtlisnnalwskmlveedpgffeklaqaqkprflwig   Crystal structure of e. Coli beta carbonic anhydrase (ecca)
1i6p:A*-------------------------kdidtlisnnalwskmlveedpgffeklaqaqkprflwig×2 Crystal structure of e. Coli beta carbonic anhydrase (ecca)
2esf:A --------------------------DIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIG   Identification of a novel non-catalytic bicarbonate binding  ...
3qy1:A --------------------------didtlisnnalwskmlveedpgffeklaqaqkprflwig   1.54a resolution crystal structure of a beta-carbonic  ...
1ddz:A vmsdlekkfieleaklvaqpagqampgksnifanneawrqemlkqdpeffnrlangqspeylwig   X-ray structure of a beta-carbonic anhydrase from the red  ...
4o1k:A -----------------------lqethdkvfennkswateqvakdpdffkklaagqnpeylwig   Crystal structures of two tetrameric beta-carbonic  ...
3ucj:A*------------------------TADLSPLLEANRKWADECAAKDSTYFSKVAGSQAPEYLYIG×5 Coccomyxa beta-carbonic anhydrase in complex with acetazolam
4o1j:A ------------------------entfhyalssnnawagykahqnphffpklaggqapeilwig   Crystal structures of two tetrameric beta-carbonic  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P45148 csdsrvpaekltnlepgelfvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggiha   Carbonic anhydrase 2 OS=Haemophilus influenzae (strain ATCC  ...
2a8c:A*CSDSRVPAEKLTNLEPGELFVHRNVANQVIHTDFNCLSVVQYAVDVLKIEHIIICGHTNCGGIHA×2 Haemophilus influenzae beta-carbonic anhydrase
3mf3:A CSDSRVPAEKLTNLEPGELFVHRNVANQVIHTDFNCLSVVQYAVDVLKIEHIIICGHTNCGGIHA   Cobalt(ii)-substituted haemophilus influenzae b-carbonic anh
3e28:A CSDSRVPAEKLTNLEPGELFVHRNVANQVIHTDFNCLSVVQYAVDVLKIEHIIICGHTNCGGIHA   H. Influenzae beta-carbonic anhydrase, variant y181f
3e2a:A CSDSRVPAEKLTNLEPGELFVHRNVANQVIHTDFNCLSVVQYAVDVLKIEHIIICGHTNCGGIHA   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e3g:A CSDSRVPAEKLTNLEPGELFVHRNVANQVIHTDFNCLSVVQYAVDVLKIEHIIICGHTNCGGIHA   H. Influenzae beta-carbonic anhydrase, variant g41a
3e28:C CSDSRVPAEKLTNLEPGELFVHRNVANQVIHTDFNCLSVVQYAVDVLKIEHIIICGHTNCGGIHA   H. Influenzae beta-carbonic anhydrase, variant y181f
3e3i:A CSDSRVPAEKLTNLEPGELFVHRNVANQVIHTDFNCLSVVQYAVDVLKIEHIIICGHTNCGGIHA   H. Influenzae beta-carbonic anhydrase, variant g41a with  ...
3e2w:A CSDSRVPAEKLTNLEPGELFVHRNVANQVIHTDFNCLSVVQYAVDVLKIEHIIICGHTNCGGIHA   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e24:A CSDSRVPAEKLTNLEPGELFVHRNVANQVIHTDFNCLSVVQYAVDVLKIEHIIICGHTNCGGIHA   H. Influenzae beta-carbonic anhydrase, variant w39f
3e31:A csdsrapaekltnlepgelfvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggiha   H. Influenzae beta-carbonic anhydrase, variant v47a
3e2x:A*CSDSRAPAEKLTNLEPGELFVHRNVANQVIHTDFNCLSVVQYAVDVLKIEHIIICGHTNCGGIHA×2 H. Influenzae beta-carbonic anhydrase, variant v47a
3e1v:A*csnsrvpaekltnlepgelfvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggiha×2 H. Influenzae beta-carbonic anhydrase, variant d44n
1i6o:A csdsrvpaerltglepgelfvhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqa   Crystal structure of e. Coli beta carbonic anhydrase (ecca)
1i6p:A*csdsrvpaerltglepgelfvhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqa×2 Crystal structure of e. Coli beta carbonic anhydrase (ecca)
2esf:A CSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGVQA   Identification of a novel non-catalytic bicarbonate binding  ...
3qy1:A csdsrvpaerltglepgelfvhrnvanlvihtdlnclsvvqyavdvlevehiiicghsgcggika   1.54a resolution crystal structure of a beta-carbonic  ...
1ddz:A cadsrvpanqlldlpagevfvhrnianqcihsdisflsvlqyavqylkvkhilvcghygcggaka   X-ray structure of a beta-carbonic anhydrase from the red  ...
4o1k:A csdsripaeqitglqpgdafvhrnianlvcntdlnvmsvieyavkhlkvkhivvcghygcggvka   Crystal structures of two tetrameric beta-carbonic  ...
3ucj:A*CADSRVSPAQLFNMAPGEVFVQRNVGNLVSNKDLNCMSCLEYTVDHLKIKHILVCGHYNCGACKA×5 Coccomyxa beta-carbonic anhydrase in complex with acetazolam
4o1j:A csdsrcpettilgmqpgdvfvhrnianivsptdinttavieyavahlkvkhivlcghsacggaag   Crystal structures of two tetrameric beta-carbonic  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P45148 ama--dkdlg-linnwllhirdiwfkhghllgklsp-ek-radmltkinvaeqvynlgrtsivks   Carbonic anhydrase 2 OS=Haemophilus influenzae (strain ATCC  ...
2a8c:A*AMA--DKDLG-LINNWLLHIRDIWFKHGHLLGKLSP-EK-RADMLTKINVAEQVYNLGRTSIVKS×2 Haemophilus influenzae beta-carbonic anhydrase
3mf3:A AMA--DKDLG-LINNWLLHIRDIWFKHGHLLGKLSP-EK-RADMLTKINVAEQVYNLGRTSIVKS   Cobalt(ii)-substituted haemophilus influenzae b-carbonic anh
3e28:A AMA--DKDLG-LINNWLLHIRDIWFKHGHLLGKLSP-EK-RADMLTKINVAEQVYNLGRTSIVKS   H. Influenzae beta-carbonic anhydrase, variant y181f
3e2a:A AMA--DKDLG-LINNWLLHIRDIWFKHGHLLGKLSP-EK-RADMLTKINVAEQVYNLGRTSIVKS   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e3g:A AMA--DKDLG-LINNWLLHIRDIWFKHGHLLGKLSP-EK-RADMLTKINVAEQVYNLGRTSIVKS   H. Influenzae beta-carbonic anhydrase, variant g41a
3e28:C AMA--DKDLG-LINNWLLHIRDIWFKHGHLLGKLSP-EK-RADMLTKINVAEQVYNLGRTSIVKS   H. Influenzae beta-carbonic anhydrase, variant y181f
3e3i:A AMA--DKDLG-LINNWLLHIRDIWFKHGHLLGKLSP-EK-RADMLTKINVAEQVYNLGRTSIVKS   H. Influenzae beta-carbonic anhydrase, variant g41a with  ...
3e2w:A AMA--DKDLG-LINNWLLHIRDIWFKHGHLLGKLSP-EK-RADMLTKINVAEQVYNLGRTSIVKS   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e24:A AMA--DKDLG-LINNWLLHIRDIWFKHGHLLGKLSP-EK-RADMLTKINVAEQVYNLGRTSIVKS   H. Influenzae beta-carbonic anhydrase, variant w39f
3e31:A ama--dkdlg-linnwllhirdiwfkhghllgklsp-ek-radmltkinvaeqvynlgrtsivks   H. Influenzae beta-carbonic anhydrase, variant v47a
3e2x:A*AMA--DKDLG-LINNWLLHIRDIWFKHGHLLGKLSP-EK-RADMLTKINVAEQVYNLGRTSIVKS×2 H. Influenzae beta-carbonic anhydrase, variant v47a
3e1v:A*ama--dkdlg-linnwllhirdiwfkhghllgklsp-ek-radmltkinvaeqvynlgrtsivks×2 H. Influenzae beta-carbonic anhydrase, variant d44n
1i6o:A ave--npelg-linnwllhirdiwfkhssllgempq-er-rldtlcelnvmeqvynlghstimqs   Crystal structure of e. Coli beta carbonic anhydrase (ecca)
1i6p:A*ave--npelg-linnwllhirdiwfkhssllgempq-er-rldtlcelnvmeqvynlghstimqs×2 Crystal structure of e. Coli beta carbonic anhydrase (ecca)
2esf:A AVE--NPELG-LINNWLLHIRDIWFKHSSLLGEMPQ-ER-RLDTLCELNVMEQVYNLGHSTIMQS   Identification of a novel non-catalytic bicarbonate binding  ...
3qy1:A ave--npelg-linnwllhirdiwlkhssllgkmpe-eq-rldalyelnvmeqvynlghstimqs   1.54a resolution crystal structure of a beta-carbonic  ...
1ddz:A alg--dsrlg-lidnwlrhirdvrrmnakyldkckdgde-elnrlielnvleqvhnvcatsivqd   X-ray structure of a beta-carbonic anhydrase from the red  ...
4o1k:A amt--pkdlg-lmnpwlrnirdvyrlhekeldaiad-eearyerlvelnvyeqcrnvvktaalqq   Crystal structures of two tetrameric beta-carbonic  ...
3ucj:A*GLVWHPKTAG-VTNLWISDVREVRDKNAAKLHGLSA-DD-AWDKMVELNVEAQVFNVCASPIVQA×5 Coccomyxa beta-carbonic anhydrase in complex with acetazolam
4o1j:A als--dgriggvldtwllplktvrynhaeeldaitd-ekerviriaqlnveagikvlmnnptire   Crystal structures of two tetrameric beta-carbonic  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P45148 aw-ergqklslhgwvydvndgflvdqgvmatsretleisyrnaiarlsildeenilkkdhlent-   Carbonic anhydrase 2 OS=Haemophilus influenzae (strain ATCC  ...
2a8c:A*AW-ERGQKLSLHGWVYDVNDGFLVDQGVMATSRETLEISYRNAIARLSILDEENIL---------×2 Haemophilus influenzae beta-carbonic anhydrase
3mf3:A AW-ERGQKLSLHGWVYDVNDGFLVDQGVMATSRETLEISYRNAIARLSILDEENIL---------   Cobalt(ii)-substituted haemophilus influenzae b-carbonic anh
3e28:A AW-ERGQKLSLHGWVFDVNDGFLVDQGVMATSRETLEISYRNAIARLSILDEENIL---------   H. Influenzae beta-carbonic anhydrase, variant y181f
3e2a:A AW-ERGQKLSLHGWVFDVNDGFLVDQGVMATSRETLEISYRNAIARLSILDEENIL---------   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e3g:A AW-ERGQKLSLHGWVYDVNDGFLVDQGVMATSRETLEISYRNAIARLSILDEENIL---------   H. Influenzae beta-carbonic anhydrase, variant g41a
3e28:C AW-ERGQKLSLHGWVFDVNDGFLVDQGVMATSRETLEISYRNAIARLSILDEEN-----------   H. Influenzae beta-carbonic anhydrase, variant y181f
3e3i:A AW-ERGQKLSLHGWVYDVNDGFLVDQGVMATSRETLEISYRNAIARLSILDEENI----------   H. Influenzae beta-carbonic anhydrase, variant g41a with  ...
3e2w:A AW-ERGQKLSLHGWVFDVNDGFLVDQGVMATSRETLEISYRNAIARLSILDEE------------   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e24:A AW-ERGQKLSLHGWVYDVNDGFLVDQGVMATSRETLEISYRNAIARLSILDEENI----------   H. Influenzae beta-carbonic anhydrase, variant w39f
3e31:A aw-ergqklslhgwvydvndgflvdqgvmatsretleisyrnaiarlsil---------------   H. Influenzae beta-carbonic anhydrase, variant v47a
3e2x:A*AW-ERGQKLSLHGWVYDVNDGFLVDQGVMATSRETLEISYRNAIARLSIL---------------×2 H. Influenzae beta-carbonic anhydrase, variant v47a
3e1v:A*aw-ergqklslhgwvydvndgflvdqgvmatsretleisyrnaiarlsil---------------×2 H. Influenzae beta-carbonic anhydrase, variant d44n
1i6o:A aw-krgqkvtihgwaygihdgllrdldvtatnretleqryrhgisnlklk---------------   Crystal structure of e. Coli beta carbonic anhydrase (ecca)
1i6p:A*aw-krgqkvtihgwaygihdgllrdldvtatnretleqryrhgisnlklk---------------×2 Crystal structure of e. Coli beta carbonic anhydrase (ecca)
2esf:A AW-KRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLK---------------   Identification of a novel non-catalytic bicarbonate binding  ...
3qy1:A aw-krgqnvtihgwaysindgllrdldvtatnretlengyhkgisalslkyi-------------   1.54a resolution crystal structure of a beta-carbonic  ...
1ddz:A aw-dagqeltvqgvvygvgdgklrdlgvvvnssddiskfyrtksdsgalkagnpnaplvqvtkgg   X-ray structure of a beta-carbonic anhydrase from the red  ...
4o1k:A sy-aengfpvihgwvfnfrdgllkdlnvdfetilkdiqkiynlt---------------------   Crystal structures of two tetrameric beta-carbonic  ...
3ucj:A*AW-ARGQPLSVHGIVYTPGTGLVKELIKPITGMEDAGALLRADLKQHCFFSESLA----------×5 Coccomyxa beta-carbonic anhydrase in complex with acetazolam
4o1j:A aiaerg--levhgvffdigcgrikelgcgta----------------------------------   Crystal structures of two tetrameric beta-carbonic  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P45148 -----------------------------------------------------------------   Carbonic anhydrase 2 OS=Haemophilus influenzae (strain ATCC  ...
2a8c:A*-----------------------------------------------------------------×2 Haemophilus influenzae beta-carbonic anhydrase
3mf3:A -----------------------------------------------------------------   Cobalt(ii)-substituted haemophilus influenzae b-carbonic anh
3e28:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant y181f
3e2a:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e3g:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant g41a
3e28:C -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant y181f
3e3i:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant g41a with  ...
3e2w:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e24:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant w39f
3e31:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant v47a
3e2x:A*-----------------------------------------------------------------×2 H. Influenzae beta-carbonic anhydrase, variant v47a
3e1v:A*-----------------------------------------------------------------×2 H. Influenzae beta-carbonic anhydrase, variant d44n
1i6o:A -----------------------------------------------------------------   Crystal structure of e. Coli beta carbonic anhydrase (ecca)
1i6p:A*-----------------------------------------------------------------×2 Crystal structure of e. Coli beta carbonic anhydrase (ecca)
2esf:A -----------------------------------------------------------------   Identification of a novel non-catalytic bicarbonate binding  ...
3qy1:A -----------------------------------------------------------------   1.54a resolution crystal structure of a beta-carbonic  ...
1ddz:A eseldstmekltaelvqqtpgklkeganrvfvnnenwrqkmlkqdpqffsnlahtqtpeilwigc   X-ray structure of a beta-carbonic anhydrase from the red  ...
4o1k:A -----------------------------------------------------------------   Crystal structures of two tetrameric beta-carbonic  ...
3ucj:A*-----------------------------------------------------------------×5 Coccomyxa beta-carbonic anhydrase in complex with acetazolam
4o1j:A -----------------------------------------------------------------   Crystal structures of two tetrameric beta-carbonic  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P45148 -----------------------------------------------------------------   Carbonic anhydrase 2 OS=Haemophilus influenzae (strain ATCC  ...
2a8c:A*-----------------------------------------------------------------×2 Haemophilus influenzae beta-carbonic anhydrase
3mf3:A -----------------------------------------------------------------   Cobalt(ii)-substituted haemophilus influenzae b-carbonic anh
3e28:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant y181f
3e2a:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e3g:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant g41a
3e28:C -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant y181f
3e3i:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant g41a with  ...
3e2w:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e24:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant w39f
3e31:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant v47a
3e2x:A*-----------------------------------------------------------------×2 H. Influenzae beta-carbonic anhydrase, variant v47a
3e1v:A*-----------------------------------------------------------------×2 H. Influenzae beta-carbonic anhydrase, variant d44n
1i6o:A -----------------------------------------------------------------   Crystal structure of e. Coli beta carbonic anhydrase (ecca)
1i6p:A*-----------------------------------------------------------------×2 Crystal structure of e. Coli beta carbonic anhydrase (ecca)
2esf:A -----------------------------------------------------------------   Identification of a novel non-catalytic bicarbonate binding  ...
3qy1:A -----------------------------------------------------------------   1.54a resolution crystal structure of a beta-carbonic  ...
1ddz:A adsrvpanqiinlpagevfvhrnianqcihsdmsflsvlqyavqylkvkrvvvcghyacggcaaa   X-ray structure of a beta-carbonic anhydrase from the red  ...
4o1k:A -----------------------------------------------------------------   Crystal structures of two tetrameric beta-carbonic  ...
3ucj:A*-----------------------------------------------------------------×5 Coccomyxa beta-carbonic anhydrase in complex with acetazolam
4o1j:A -----------------------------------------------------------------   Crystal structures of two tetrameric beta-carbonic  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P45148 -----------------------------------------------------------------   Carbonic anhydrase 2 OS=Haemophilus influenzae (strain ATCC  ...
2a8c:A*-----------------------------------------------------------------×2 Haemophilus influenzae beta-carbonic anhydrase
3mf3:A -----------------------------------------------------------------   Cobalt(ii)-substituted haemophilus influenzae b-carbonic anh
3e28:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant y181f
3e2a:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e3g:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant g41a
3e28:C -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant y181f
3e3i:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant g41a with  ...
3e2w:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e24:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant w39f
3e31:A -----------------------------------------------------------------   H. Influenzae beta-carbonic anhydrase, variant v47a
3e2x:A*-----------------------------------------------------------------×2 H. Influenzae beta-carbonic anhydrase, variant v47a
3e1v:A*-----------------------------------------------------------------×2 H. Influenzae beta-carbonic anhydrase, variant d44n
1i6o:A -----------------------------------------------------------------   Crystal structure of e. Coli beta carbonic anhydrase (ecca)
1i6p:A*-----------------------------------------------------------------×2 Crystal structure of e. Coli beta carbonic anhydrase (ecca)
2esf:A -----------------------------------------------------------------   Identification of a novel non-catalytic bicarbonate binding  ...
3qy1:A -----------------------------------------------------------------   1.54a resolution crystal structure of a beta-carbonic  ...
1ddz:A lgdsrlglidnwlrhirdvrrhnqaelsritdpkdslnrlieinvleqmhnvcatsivqdawdag   X-ray structure of a beta-carbonic anhydrase from the red  ...
4o1k:A -----------------------------------------------------------------   Crystal structures of two tetrameric beta-carbonic  ...
3ucj:A*-----------------------------------------------------------------×5 Coccomyxa beta-carbonic anhydrase in complex with acetazolam
4o1j:A -----------------------------------------------------------------   Crystal structures of two tetrameric beta-carbonic  ...

           4         4         4      
           6         7         8      
       6789012345678901234567890123456                                     Protein name
       ----+---------+---------+------                                     ------------
P45148 -------------------------------                                     Carbonic anhydrase 2 OS=Haemophilus influenzae (strain ATCC  ...
2a8c:A*-------------------------------                                  ×2 Haemophilus influenzae beta-carbonic anhydrase
3mf3:A -------------------------------                                     Cobalt(ii)-substituted haemophilus influenzae b-carbonic anh
3e28:A -------------------------------                                     H. Influenzae beta-carbonic anhydrase, variant y181f
3e2a:A -------------------------------                                     H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e3g:A -------------------------------                                     H. Influenzae beta-carbonic anhydrase, variant g41a
3e28:C -------------------------------                                     H. Influenzae beta-carbonic anhydrase, variant y181f
3e3i:A -------------------------------                                     H. Influenzae beta-carbonic anhydrase, variant g41a with  ...
3e2w:A -------------------------------                                     H. Influenzae beta-carbonic anhydrase, variant y181f with  ...
3e24:A -------------------------------                                     H. Influenzae beta-carbonic anhydrase, variant w39f
3e31:A -------------------------------                                     H. Influenzae beta-carbonic anhydrase, variant v47a
3e2x:A*-------------------------------                                  ×2 H. Influenzae beta-carbonic anhydrase, variant v47a
3e1v:A*-------------------------------                                  ×2 H. Influenzae beta-carbonic anhydrase, variant d44n
1i6o:A -------------------------------                                     Crystal structure of e. Coli beta carbonic anhydrase (ecca)
1i6p:A*-------------------------------                                  ×2 Crystal structure of e. Coli beta carbonic anhydrase (ecca)
2esf:A -------------------------------                                     Identification of a novel non-catalytic bicarbonate binding  ...
3qy1:A -------------------------------                                     1.54a resolution crystal structure of a beta-carbonic  ...
1ddz:A qelevqgvvygvgdgklrdmgvvakanddig                                     X-ray structure of a beta-carbonic anhydrase from the red  ...
4o1k:A -------------------------------                                     Crystal structures of two tetrameric beta-carbonic  ...
3ucj:A*-------------------------------                                  ×5 Coccomyxa beta-carbonic anhydrase in complex with acetazolam
4o1j:A -------------------------------                                     Crystal structures of two tetrameric beta-carbonic  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P45148. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 229 - - P45148 Carbonic anhydrase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=can PE=1 SV=1
2. 1492 100.0% 221 221 1906.8 3.1e-99 2a8c:A * Haemophilus influenzae beta-carbonic anhydrase
3. " " " " " "  = 2a8d:A *
Haemophilus influenzae beta-carbonic anhydrase complexed with bicarbonate
4. 1485 100.0% 220 220 1897.9 9.7e-99 3mf3:A Cobalt(ii)-substituted haemophilus influenzae b-carbonic anh
5. 1428 96.8% 221 215 1825.4 1.1e-94 3e28:A H. Influenzae beta-carbonic anhydrase, variant y181f
6. 1379 94.1% 221 209 1640.6 2.1e-84 3e2a:A H. Influenzae beta-carbonic anhydrase, variant y181f with 10 bicarbonate
7. 1355 93.2% 221 207 1621.6 2.4e-83 3e3g:A H. Influenzae beta-carbonic anhydrase, variant g41a
8. 1340 92.7% 219 204 1611.5 8.8e-83 3e28:C H. Influenzae beta-carbonic anhydrase, variant y181f
9. 1365 94.1% 220 208 1610.1 1.1e-82 3e3i:A H. Influenzae beta-carbonic anhydrase, variant g41a with 100 bicarbonate
10. 1375 95.0% 218 208 1608.8 1.2e-82 3e2w:A H. Influenzae beta-carbonic anhydrase, variant y181f with 1m bicarbonate
11. 1245 99.5% 186 186 1592.9 9.4e-82 3e24:A H. Influenzae beta-carbonic anhydrase, variant w39f
12. 1234 99.5% 183 183 1579.0 5.6e-81 3e31:A H. Influenzae beta-carbonic anhydrase, variant v47a
13. 1227 99.5% 182 182 1570.1 1.8e-80 3e2x:A * H. Influenzae beta-carbonic anhydrase, variant v47a
14. " " " " " "  = 3e3f:A *
H. Influenzae beta-carbonic anhydrase, variant v47a with 100 bicarbonate
15. 1226 99.5% 182 182 1568.8 2.1e-80 3e1v:A * H. Influenzae beta-carbonic anhydrase, variant d44n
16. " " " " " "  = 3e1w:A *
H. Influenzae beta-carbonic anhydrase, variant d44n in 100 m bicarbonate
17. 966 63.5% 211 213 1236.2 7e-62 1i6o:A Crystal structure of e. Coli beta carbonic anhydrase (ecca)
18. 966 63.5% 211 214 1236.2 7e-62 1i6p:A * Crystal structure of e. Coli beta carbonic anhydrase (ecca)
19. " " " " " "  = 1t75:A *
Crystal structure of escherichia coli beta carbonic anhydras
20. 966 63.5% 211 213 1236.2 7e-62 2esf:A Identification of a novel non-catalytic bicarbonate binding eubacterial beta-carbonic anhydrase
21. 964 64.0% 211 215 1233.6 9.7e-62 3qy1:A 1.54a resolution crystal structure of a beta-carbonic anhydr salmonella enterica subsp. Enterica serovar typhimurium str
22. 703 49.3% 207 481 895.5 6.6e-43 1ddz:A X-ray structure of a beta-carbonic anhydrase from the red alga, porphyridium purpureum r-1
23. 641 47.1% 189 211 821.8 8.4e-39 4o1k:A Crystal structures of two tetrameric beta-carbonic anhydrase filamentous ascomycete sordaria macrospora.
24. 546 42.8% 187 222 700.4 4.9e-32 3ucj:A * Coccomyxa beta-carbonic anhydrase in complex with acetazolam
25. " " " " " "  = 3uck:A *
Coccomyxa beta-carbonic anhydrase in complex with phosphate
26. " " " " " "  = 3ucm:A *
Coccomyxa beta-carbonic anhydrase in complex with thiocyanat
27. " " " " " "  = 3ucn:A *
Coccomyxa beta-carbonic anhydrase in complex with azide
28. " " " " " "  = 3uco:A *
Coccomyxa beta-carbonic anhydrase in complex with iodide
29. 475 37.2% 188 197 610.6 4.9e-27 4o1j:A Crystal structures of two tetrameric beta-carbonic anhydrase filamentous ascomycete sordaria macrospora.

Number of sequences: 29

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 387 33.5% 197 229 497.4 9.9e-21 2w3q:A Structure and inhibition of the co2-sensing carbonic anhydrase can2 from the pathogenic fungus cryptococcus neoformans
2. 383 33.3% 201 230 492.3 1.9e-20 2w3n:A Structure and inhibition of the co2-sensing carbonic anhydrase can2 from the pathogenic fungus cryptococcus neoformans
3. 321 31.4% 194 197 414.2 4.3e-16 3eyx:A Crystal structure of carbonic anhydrase nce103 from saccharomyces cerevisiae
4. 249 32.2% 183 193 322.5 5.5e-11 1ym3:A Crystal structure of carbonic anhydrase rv3588c from mycobac tuberculosis
5. 247 33.8% 160 210 319.4 8.1e-11 2a5v:A Crystal structure of m. Tuberculosis beta carbonic anhydrase tetrameric form
6. 224 38.3% 94 210 290.1 3.5e-09 1ekj:A The x-ray crystallographic structure of beta carbonic anhydrase from the c3 dicot pisum sativum
7. 143 25.9% 174 169 167.8 0.023 1g5c:A Crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum
8. 120 35.9% 64 212 157.4 0.086 3vrk:A Crystal structutre of thiobacillus thioparus thi115 carbonyl hydrolase / thiocyanate complex
9. 120 35.9% 64 214 157.3 0.087 3vqj:A Crystal structutre of thiobacillus thioparus thi115 carbonyl hydrolase
10. 125 24.5% 155 163 147.6 0.3 1ylk:A Crystal structure of rv1284 from mycobacterium tuberculosis with thiocyanate
11. 110 28.8% 66 201 145.0 0.42 3ten:A Holo form of carbon disulfide hydrolase
12. 110 28.8% 66 202 145.0 0.42 3teo:A Apo form of carbon disulfide hydrolase (selenomethionine for
13. 121 26.2% 160 158 140.2 0.78 1g5c:B Crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum
14. 102 30.2% 96 113 138.5 0.97 4hyl:A The crystal structure of an anti-sigma-factor antagonist fro haliangium ochraceum dsm 14365
15. 93 33.3% 57 90 128.6 3.5 3tnv:A Acylphosphatase with thermophilic surface and mesophilic cor
16. 97 26.0% 123 292 126.0 4.8 3r7p:A The crystal structure of i-ltri
17. 94 24.4% 172 492 118.7 12 1a3w:A Pyruvate kinase from saccharomyces cerevisiae complexed with mn2+ and k+
18. 84 30.8% 91 98 116.5 16 2acy:A Acyl-phosphatase (common type) from bovine testis
19. 84 23.5% 119 175 112.7 26 4d00:B Haemagglutinin of h10n8 influenza virus isolated from humans in complex with human receptor analogue 6'sln
20. 83 25.4% 63 166 111.8 30 3las:A Crystal structure of carbonic anhydrase from streptococcus m 1.4 angstrom resolution
21. 80 30.3% 89 94 111.7 30 2vh7:A Crystal structure of human common-type acylphosphatase
22. 80 30.3% 89 95 111.6 31 2w4c:A Human common-type acylphosphatase variant, a99
23. 80 30.3% 89 96 111.6 31 2w4p:A Human common-type acylphosphatase variant, a99g
24. 80 30.3% 89 99 111.4 32 2k7j:A Human acylphosphatase(acph) surface charge-optimized
25. 80 30.3% 89 99 111.4 32 2k7k:A Human acylphosphatase (acph) common type
26. 86 32.7% 49 341 110.9 33 4onz:A Crystal structure of a putative glycoside hydrolase (bacova_ from bacteroides ovatus atcc 8483 at 1.85 a resolution
27. 89 28.7% 87 630 110.8 34 3sgl:A The crystal structure of mnmc from yersinia pestis bound wit sam
28. 89 28.7% 87 635 110.7 34 3pvc:A Crystal structure of apo mnmc from yersinia pestis
29. 82 24.4% 127 168 110.5 35 3tfz:A Crystal structure of zhui aromatase/cyclase from streptomcye r1128

Number of sequences: 29

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer