
SAS results for UniProt accession no. P07552

Sequence annotated by structure

Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.


FASTA alignment for UniProt accession no. P07552 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P07552 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.



The search returned 27 unique sequences (including 6 consensus sequences) giving 43 sequence matches in all. The 7 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Show secondary structure: Yes No  

                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P07552 -----------------------------------------------------------------   Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11  ...
1sqq:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with methoxy  ...
1sqx:K*-----------------------------------------------------------------×2 Crystal structure analysis of bovine bc1 with stigmatellin a
1l0l:K*-----------------------------------------------------------------×4 Structure of bovine mitochondrial cytochrome bc1 complex  ...
1sqp:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with myxothiazol
1sqv:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with uhdbt
1ntm:K -----------------------------------------------------------------   Crystal structure of mitochondrial cytochrome bc1 complex  ...
1sqb:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with azoxystrobin
1l0n:K -----------------------------------------------------------------   Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:K -----------------------------------------------------------------   Crystal structure of bovine mitochondrial cytochrome bc1  ...
1be3:K*-----------------------------------------------------------------×3 Cytochrome bc1 complex from bovine
3wc3:A fqynydevleksilfyeaersgdlpannripyrgdsalgdqgnqgqdltggwydagdhvkfgfpm   Crystal structure of endo-1,4-beta-glucanase from eisenia fe
1orv:A*---------------------------------srrtytltdylkstfrvkfytlqwisdheyly×8 Crystal structure of porcine dipeptidyl peptidase iv (cd26)
4ifd:I -----------------------------------------------------------------   Crystal structure of an 11-subunit eukaryotic exosome  ...
3mgb:A -----------------------------------------------------------------   Teg 12 ternary structure complexed with pap and the  ...
1xp2:A*-----------------------------------------------------------------×2 Crystal structure of the enzymatically active domain of the  ...
3r40:A --------------------------------------------ladlfpgfgsewintssgrif   Crystal structure of the fluoroacetate dehalogenase rpa1163  ...
3reb:A -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
3bxt:A*-----------------------------------------------------------------×3 Crystal structure of sc4828, a unique phosphatase from  ...
3reb:C -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
2vat:A -----------------------------------------------------------------   Crystal structure of deacetylcephalosporin c  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P07552 -----------------------------------------------------------------   Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11  ...
1sqq:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with methoxy  ...
1sqx:K*-----------------------------------------------------------------×2 Crystal structure analysis of bovine bc1 with stigmatellin a
1l0l:K*-----------------------------------------------------------------×4 Structure of bovine mitochondrial cytochrome bc1 complex  ...
1sqp:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with myxothiazol
1sqv:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with uhdbt
1ntm:K -----------------------------------------------------------------   Crystal structure of mitochondrial cytochrome bc1 complex  ...
1sqb:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with azoxystrobin
1l0n:K -----------------------------------------------------------------   Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:K -----------------------------------------------------------------   Crystal structure of bovine mitochondrial cytochrome bc1  ...
1be3:K*-----------------------------------------------------------------×3 Cytochrome bc1 complex from bovine
3wc3:A afatttlawgilefrdgyeaagqynlaldsirwtlnyflkahvsdnefygqvgdantdhaywgrp   Crystal structure of endo-1,4-beta-glucanase from eisenia fe
1orv:A*kqennillfnaeygnssiflenstfdelgystndysvspdrqfilfeynyvkqwrhsytasydiy×8 Crystal structure of porcine dipeptidyl peptidase iv (cd26)
4ifd:I ---------------------------macnfqfpeiaypgklicpqygtenkdgediifnyvpg   Crystal structure of an 11-subunit eukaryotic exosome  ...
3mgb:A -----------------------------------------------------------------   Teg 12 ternary structure complexed with pap and the  ...
1xp2:A*-----------------------------------------------------------------×2 Crystal structure of the enzymatically active domain of the  ...
3r40:A arvggdgppllllhgfpqthvmwhrvapklaerfkvivadlpgygwsdmpesdeqhtpytkrama   Crystal structure of the fluoroacetate dehalogenase rpa1163  ...
3reb:A -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
3bxt:A*-----------------------------------------------------------------×3 Crystal structure of sc4828, a unique phosphatase from  ...
3reb:C -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
2vat:A -----------------------------------------------------nrfeasldaqdi   Crystal structure of deacetylcephalosporin c  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P07552 -----------------------------------------------------------------   Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11  ...
1sqq:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with methoxy  ...
1sqx:K*-----------------------------------------------------------------×2 Crystal structure analysis of bovine bc1 with stigmatellin a
1l0l:K*-----------------------------------------------------------------×4 Structure of bovine mitochondrial cytochrome bc1 complex  ...
1sqp:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with myxothiazol
1sqv:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with uhdbt
1ntm:K -----------------------------------------------------------------   Crystal structure of mitochondrial cytochrome bc1 complex  ...
1sqb:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with azoxystrobin
1l0n:K -----------------------------------------------------------------   Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:K -----------------------------------------------------------------   Crystal structure of bovine mitochondrial cytochrome bc1  ...
1be3:K*-----------------------------------------------------------------×3 Cytochrome bc1 complex from bovine
3wc3:A edmtmerpawsispsapgsdlaaetaaalaagylvfrdsdaafannllahsrtlydfalnnrgiy   Crystal structure of endo-1,4-beta-glucanase from eisenia fe
1orv:A*dlnkrqliteeripnntqwitwspvghklayvwnndiyvknepnlssqritwtgkenviyngvtd×8 Crystal structure of porcine dipeptidyl peptidase iv (cd26)
4ifd:I pgtkliqyehngrtleaitatlvgtvrceeekktrrtvknilvsvlpgndfannlpkegdivltr   Crystal structure of an 11-subunit eukaryotic exosome  ...
3mgb:A ---------------------sshhhhhhsssmngirwiasypkagntwvrcmlaayitgkapqv   Teg 12 ternary structure complexed with pap and the  ...
1xp2:A*---------------------------------------------------amalteawliekan×2 Crystal structure of the enzymatically active domain of the  ...
3r40:A kqlieameqlghvhfalaghnrgarvsyrlaldspgrlsklavldilptyeywqrmnrayalkiy   Crystal structure of the fluoroacetate dehalogenase rpa1163  ...
3reb:A -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
3bxt:A*-----------------------------------------------------------------×3 Crystal structure of sc4828, a unique phosphatase from  ...
3reb:C -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
2vat:A arislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvtswwptlfgqgrafdtsr   Crystal structure of deacetylcephalosporin c  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P07552 -----------------------------------------------------------------   Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11  ...
1sqq:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with methoxy  ...
1sqx:K*-----------------------------------------------------------------×2 Crystal structure analysis of bovine bc1 with stigmatellin a
1l0l:K*-----------------------------------------------------------------×4 Structure of bovine mitochondrial cytochrome bc1 complex  ...
1sqp:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with myxothiazol
1sqv:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with uhdbt
1ntm:K -----------------------------------------------------------------   Crystal structure of mitochondrial cytochrome bc1 complex  ...
1sqb:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with azoxystrobin
1l0n:K -----------------------------------------------------------------   Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:K -----------------------------------------------------------------   Crystal structure of bovine mitochondrial cytochrome bc1  ...
1be3:K*-----------------------------------------------------------------×3 Cytochrome bc1 complex from bovine
3wc3:A sqsisnaagfyassayedelawgaawlyrateeqeyldrayefgtttntawaydwnekivgyqll   Crystal structure of endo-1,4-beta-glucanase from eisenia fe
1orv:A*wvyeeevfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvripypkagaenpt×8 Crystal structure of porcine dipeptidyl peptidase iv (cd26)
4ifd:I vtrlslqranveilavedkpaatfsvsqassdlgetfrgiirsqdvrstdrdrvkviecfkpgdi   Crystal structure of an 11-subunit eukaryotic exosome  ...
3mgb:A wndidaesltleamlrfgdlppaepmepvlvkthlkadvpvlglygeatakvlylvrnprdmlls   Teg 12 ternary structure complexed with pap and the  ...
1xp2:A*rklnaggmykitsdktrnvikkmakegiylcvaqgyrstaeqnalyaqgrtkpgaivtnakggqs×2 Crystal structure of the enzymatically active domain of the  ...
3r40:A hwsflaqpaplpenllggdpdfyvkaklaswtragdlsafdpravehyriafadpmrrhvmcedy   Crystal structure of the fluoroacetate dehalogenase rpa1163  ...
3reb:A -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
3bxt:A*--------ghwapgshilwryrenggphvhiarpvtvvrddadllavwlapgtecvkpvladgtp×3 Crystal structure of sc4828, a unique phosphatase from  ...
3reb:C -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
2vat:A yfiiclnylgspfgsagpcspdpdaerpygakfprttirddvrihrqvldrlgvrqiaavvgasm   Crystal structure of deacetylcephalosporin c  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P07552 -----mltrflgpryrqlarnwvptas-l-w----gavgavglvwatdw-rlild-wvpyingkf   Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11  ...
1sqq:K -----mltrflgpryrqlarnwvptas-l-w----gavgavglvwatdw-rlild-wvpyingkf   Crystal structure analysis of bovine bc1 with methoxy  ...
1sqx:K*-----mltrflgpryrqlarnwvptas-l-w----gavgavglvwatdw-rlild-wvpyingkf×2 Crystal structure analysis of bovine bc1 with stigmatellin a
1l0l:K*-----mltrflgpryrqlarnwvptaq-l-w----gavgavglvwatdw-rlild-wvpyingkf×4 Structure of bovine mitochondrial cytochrome bc1 complex  ...
1sqp:K -----MLTRFLGPRYRQLARNWVPTAG-L-W----GAVGAVGLVWATDW-RLILD-WVPYINGKF   Crystal structure analysis of bovine bc1 with myxothiazol
1sqv:K -----mltrflgpryrqlarnwvptas-l-w----gavgavglvwatdw-rlild-wvpyingk-   Crystal structure analysis of bovine bc1 with uhdbt
1ntm:K -----mltrflgpryrqlarnwvptaq-l-w----gavgavglvwatdw-rlild-wvpyingk-   Crystal structure of mitochondrial cytochrome bc1 complex  ...
1sqb:K ------ltrflgpryrqlarnwvptaq-l-w----gavgavglvwatds-rlild-wvpyingkf   Crystal structure analysis of bovine bc1 with azoxystrobin
1l0n:K -----mltrflgpryrqlarnwvptaq-l-w----gavgavglvsatds-rlild-wvptin---   Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:K -----mltrflgpryrqlarnwvptaq-l-w----gavgavglvsatds-rlild-wv-------   Crystal structure of bovine mitochondrial cytochrome bc1  ...
1be3:K*-------------------rnwvptaq-l-w----gavgavglvsat------------------×3 Cytochrome bc1 complex from bovine
3wc3:A lttsagqtdfl-prvenflrnwfpggs-v-q----yt--plglawlaqw-gpnry-aanaafial   Crystal structure of endo-1,4-beta-glucanase from eisenia fe
1orv:A*vkffvvdtrtlspnasvtsyqivppasvl-i----gdhylcgvtwvtee-rislq-wirraqnys×8 Crystal structure of porcine dipeptidyl peptidase iv (cd26)
4ifd:I vraqvlslgdgtnyylttarndlgvvf-a-r----aangagglmyatdw-qmmts-pvtgatekr   Crystal structure of an 11-subunit eukaryotic exosome  ...
3mgb:A smrmasisrddveksrdfarkfianeg-lgw----nalgagggvglgswpenvrs-wtesssdrf   Teg 12 ternary structure complexed with pap and the  ...
1xp2:A*nhnygvavdlclytndgkdviwestts-r-wkkvvaamkaegfkwggdw-ksfkd-yphfelcda×2 Crystal structure of the enzymatically active domain of the  ...
3r40:A ragayadfehdkidveagnkipvpmla-l-w----gasgipldvw-rkw-asdvq-gapiesghf   Crystal structure of the fluoroacetate dehalogenase rpa1163  ...
3reb:A ------vrpqvplrpmtykaaldishf-l-k----ekgglegliwsqrr-qeildlwiyhtqgyf   HIV-1 nef protein in complex with engineered hck-sh3 domain
3bxt:A*vhleplatrytkprtvqrdq-wfgtgv-l-klarpgeawsvwlfwdpgw-rfk-n-w--yvnler×3 Crystal structure of sc4828, a unique phosphatase from  ...
3reb:C -evgfpvrpqvplrpmtykaaldishf-l-k----ekgglegliwsqrr-qeildlwiyhtqgyf   HIV-1 nef protein in complex with engineered hck-sh3 domain
2vat:A ggmhtlewaffgpey---vrkivpiat-s-c----rqsgwcaawfetqr-qciyd-dpkyldgey   Crystal structure of deacetylcephalosporin c  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P07552 kkdd-------------------------------------------------------------   Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11  ...
1sqq:K kk---------------------------------------------------------------   Crystal structure analysis of bovine bc1 with methoxy  ...
1sqx:K*k----------------------------------------------------------------×2 Crystal structure analysis of bovine bc1 with stigmatellin a
1l0l:K*k----------------------------------------------------------------×4 Structure of bovine mitochondrial cytochrome bc1 complex  ...
1sqp:K K----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with myxothiazol
1sqv:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with uhdbt
1ntm:K -----------------------------------------------------------------   Crystal structure of mitochondrial cytochrome bc1 complex  ...
1sqb:K k----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with azoxystrobin
1l0n:K -----------------------------------------------------------------   Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:K -----------------------------------------------------------------   Crystal structure of bovine mitochondrial cytochrome bc1  ...
1be3:K*-----------------------------------------------------------------×3 Cytochrome bc1 complex from bovine
3wc3:A vsakynilaseseqfarsqihymlgdagrsyvvgfgnnppqqphhrssscpdqpaecdwdefnqp   Crystal structure of endo-1,4-beta-glucanase from eisenia fe
1orv:A*iidicdydestgrwissvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfq×8 Crystal structure of porcine dipeptidyl peptidase iv (cd26)
4ifd:I kcakp------------------------------------------------------------   Crystal structure of an 11-subunit eukaryotic exosome  ...
3mgb:A pnadvltmryedlkgdpvarfseivefldlggpvdiedirravaastlermrelekrsggspimm   Teg 12 ternary structure complexed with pap and the  ...
1xp2:A*vsgekipaa--------------------------------------------------------×2 Crystal structure of the enzymatically active domain of the  ...
3r40:A lpeeapdqtaealvrffsa----------------------------------------------   Crystal structure of the fluoroacetate dehalogenase rpa1163  ...
3reb:A pdwqnytpgpgirypltfgwcfklvpvepevlvwrfdsklafhhmarelhpeyy-----------   HIV-1 nef protein in complex with engineered hck-sh3 domain
3bxt:A*pltrweggvdsedhfldisvhpdrtwhwrdedefaqalrdglmdpasagrvrragrsavaeiraw×3 Crystal structure of sc4828, a unique phosphatase from  ...
3reb:C pdwqnytpgpgirypltfgwcfklvpvepeekevlvwrfdsklafhhmarelhpeyy--------   HIV-1 nef protein in complex with engineered hck-sh3 domain
2vat:A dvddqpvrgletarkianltykskpamderfhmapgvqpieavssylryqaqkfaasfdancyia   Crystal structure of deacetylcephalosporin c  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P07552 -----------------------------------------------------------------   Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11  ...
1sqq:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with methoxy  ...
1sqx:K*-----------------------------------------------------------------×2 Crystal structure analysis of bovine bc1 with stigmatellin a
1l0l:K*-----------------------------------------------------------------×4 Structure of bovine mitochondrial cytochrome bc1 complex  ...
1sqp:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with myxothiazol
1sqv:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with uhdbt
1ntm:K -----------------------------------------------------------------   Crystal structure of mitochondrial cytochrome bc1 complex  ...
1sqb:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with azoxystrobin
1l0n:K -----------------------------------------------------------------   Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:K -----------------------------------------------------------------   Crystal structure of bovine mitochondrial cytochrome bc1  ...
1be3:K*-----------------------------------------------------------------×3 Cytochrome bc1 complex from bovine
3wc3:A gpnyqilygalvggpdqndqfedlrsdyirnevandynagfqgavaalraiqlrdg---------   Crystal structure of endo-1,4-beta-glucanase from eisenia fe
1orv:A*tdksnctfitkgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnper×8 Crystal structure of porcine dipeptidyl peptidase iv (cd26)
4ifd:I -----------------------------------------------------------------   Crystal structure of an 11-subunit eukaryotic exosome  ...
3mgb:A kggpggarpqfvgegrydqslsflgediesdyqellhgdsgfalyakqygyag------------   Teg 12 ternary structure complexed with pap and the  ...
1xp2:A*-----------------------------------------------------------------×2 Crystal structure of the enzymatically active domain of the  ...
3r40:A -----------------------------------------------------------------   Crystal structure of the fluoroacetate dehalogenase rpa1163  ...
3reb:A -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
3bxt:A*gspfadgwehwrpdpawpvpslpgdwdrtpa----------------------------------×3 Crystal structure of sc4828, a unique phosphatase from  ...
3reb:C -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
2vat:A mtlkfdthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg   Crystal structure of deacetylcephalosporin c  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P07552 -----------------------------------------------------------------   Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11  ...
1sqq:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with methoxy  ...
1sqx:K*-----------------------------------------------------------------×2 Crystal structure analysis of bovine bc1 with stigmatellin a
1l0l:K*-----------------------------------------------------------------×4 Structure of bovine mitochondrial cytochrome bc1 complex  ...
1sqp:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with myxothiazol
1sqv:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with uhdbt
1ntm:K -----------------------------------------------------------------   Crystal structure of mitochondrial cytochrome bc1 complex  ...
1sqb:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with azoxystrobin
1l0n:K -----------------------------------------------------------------   Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:K -----------------------------------------------------------------   Crystal structure of bovine mitochondrial cytochrome bc1  ...
1be3:K*-----------------------------------------------------------------×3 Cytochrome bc1 complex from bovine
3wc3:A -----------------------------------------------------------------   Crystal structure of endo-1,4-beta-glucanase from eisenia fe
1orv:A*cqyysasfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin×8 Crystal structure of porcine dipeptidyl peptidase iv (cd26)
4ifd:I -----------------------------------------------------------------   Crystal structure of an 11-subunit eukaryotic exosome  ...
3mgb:A -----------------------------------------------------------------   Teg 12 ternary structure complexed with pap and the  ...
1xp2:A*-----------------------------------------------------------------×2 Crystal structure of the enzymatically active domain of the  ...
3r40:A -----------------------------------------------------------------   Crystal structure of the fluoroacetate dehalogenase rpa1163  ...
3reb:A -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
3bxt:A*-----------------------------------------------------------------×3 Crystal structure of sc4828, a unique phosphatase from  ...
3reb:C -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
2vat:A hdffvmeadkvndavrgfldq--------------------------------------------   Crystal structure of deacetylcephalosporin c  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P07552 -----------------------------------------------------------------   Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11  ...
1sqq:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with methoxy  ...
1sqx:K*-----------------------------------------------------------------×2 Crystal structure analysis of bovine bc1 with stigmatellin a
1l0l:K*-----------------------------------------------------------------×4 Structure of bovine mitochondrial cytochrome bc1 complex  ...
1sqp:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with myxothiazol
1sqv:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with uhdbt
1ntm:K -----------------------------------------------------------------   Crystal structure of mitochondrial cytochrome bc1 complex  ...
1sqb:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with azoxystrobin
1l0n:K -----------------------------------------------------------------   Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:K -----------------------------------------------------------------   Crystal structure of bovine mitochondrial cytochrome bc1  ...
1be3:K*-----------------------------------------------------------------×3 Cytochrome bc1 complex from bovine
3wc3:A -----------------------------------------------------------------   Crystal structure of endo-1,4-beta-glucanase from eisenia fe
1orv:A*lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasfdgrgs×8 Crystal structure of porcine dipeptidyl peptidase iv (cd26)
4ifd:I -----------------------------------------------------------------   Crystal structure of an 11-subunit eukaryotic exosome  ...
3mgb:A -----------------------------------------------------------------   Teg 12 ternary structure complexed with pap and the  ...
1xp2:A*-----------------------------------------------------------------×2 Crystal structure of the enzymatically active domain of the  ...
3r40:A -----------------------------------------------------------------   Crystal structure of the fluoroacetate dehalogenase rpa1163  ...
3reb:A -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
3bxt:A*-----------------------------------------------------------------×3 Crystal structure of sc4828, a unique phosphatase from  ...
3reb:C -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
2vat:A -----------------------------------------------------------------   Crystal structure of deacetylcephalosporin c  ...

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P07552 -----------------------------------------------------------------   Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11  ...
1sqq:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with methoxy  ...
1sqx:K*-----------------------------------------------------------------×2 Crystal structure analysis of bovine bc1 with stigmatellin a
1l0l:K*-----------------------------------------------------------------×4 Structure of bovine mitochondrial cytochrome bc1 complex  ...
1sqp:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with myxothiazol
1sqv:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with uhdbt
1ntm:K -----------------------------------------------------------------   Crystal structure of mitochondrial cytochrome bc1 complex  ...
1sqb:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with azoxystrobin
1l0n:K -----------------------------------------------------------------   Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:K -----------------------------------------------------------------   Crystal structure of bovine mitochondrial cytochrome bc1  ...
1be3:K*-----------------------------------------------------------------×3 Cytochrome bc1 complex from bovine
3wc3:A -----------------------------------------------------------------   Crystal structure of endo-1,4-beta-glucanase from eisenia fe
1orv:A*gyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsmvlgagsgvfk×8 Crystal structure of porcine dipeptidyl peptidase iv (cd26)
4ifd:I -----------------------------------------------------------------   Crystal structure of an 11-subunit eukaryotic exosome  ...
3mgb:A -----------------------------------------------------------------   Teg 12 ternary structure complexed with pap and the  ...
1xp2:A*-----------------------------------------------------------------×2 Crystal structure of the enzymatically active domain of the  ...
3r40:A -----------------------------------------------------------------   Crystal structure of the fluoroacetate dehalogenase rpa1163  ...
3reb:A -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
3bxt:A*-----------------------------------------------------------------×3 Crystal structure of sc4828, a unique phosphatase from  ...
3reb:C -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
2vat:A -----------------------------------------------------------------   Crystal structure of deacetylcephalosporin c  ...

                6         6         6         6         7         7     
                6         7         8         9         0         1     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P07552 -----------------------------------------------------------------   Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11  ...
1sqq:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with methoxy  ...
1sqx:K*-----------------------------------------------------------------×2 Crystal structure analysis of bovine bc1 with stigmatellin a
1l0l:K*-----------------------------------------------------------------×4 Structure of bovine mitochondrial cytochrome bc1 complex  ...
1sqp:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with myxothiazol
1sqv:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with uhdbt
1ntm:K -----------------------------------------------------------------   Crystal structure of mitochondrial cytochrome bc1 complex  ...
1sqb:K -----------------------------------------------------------------   Crystal structure analysis of bovine bc1 with azoxystrobin
1l0n:K -----------------------------------------------------------------   Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:K -----------------------------------------------------------------   Crystal structure of bovine mitochondrial cytochrome bc1  ...
1be3:K*-----------------------------------------------------------------×3 Cytochrome bc1 complex from bovine
3wc3:A -----------------------------------------------------------------   Crystal structure of endo-1,4-beta-glucanase from eisenia fe
1orv:A*cgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqveyllihgtaddnvhf×8 Crystal structure of porcine dipeptidyl peptidase iv (cd26)
4ifd:I -----------------------------------------------------------------   Crystal structure of an 11-subunit eukaryotic exosome  ...
3mgb:A -----------------------------------------------------------------   Teg 12 ternary structure complexed with pap and the  ...
1xp2:A*-----------------------------------------------------------------×2 Crystal structure of the enzymatically active domain of the  ...
3r40:A -----------------------------------------------------------------   Crystal structure of the fluoroacetate dehalogenase rpa1163  ...
3reb:A -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
3bxt:A*-----------------------------------------------------------------×3 Crystal structure of sc4828, a unique phosphatase from  ...
3reb:C -----------------------------------------------------------------   HIV-1 nef protein in complex with engineered hck-sh3 domain
2vat:A -----------------------------------------------------------------   Crystal structure of deacetylcephalosporin c  ...

           7         7         7         7         7        
           2         3         4         5         6        
       67890123456789012345678901234567890123456789012345678               Protein name
       ----+---------+---------+---------+---------+--------               ------------
P07552 -----------------------------------------------------               Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11  ...
1sqq:K -----------------------------------------------------               Crystal structure analysis of bovine bc1 with methoxy  ...
1sqx:K*-----------------------------------------------------            ×2 Crystal structure analysis of bovine bc1 with stigmatellin a
1l0l:K*-----------------------------------------------------            ×4 Structure of bovine mitochondrial cytochrome bc1 complex  ...
1sqp:K -----------------------------------------------------               Crystal structure analysis of bovine bc1 with myxothiazol
1sqv:K -----------------------------------------------------               Crystal structure analysis of bovine bc1 with uhdbt
1ntm:K -----------------------------------------------------               Crystal structure of mitochondrial cytochrome bc1 complex  ...
1sqb:K -----------------------------------------------------               Crystal structure analysis of bovine bc1 with azoxystrobin
1l0n:K -----------------------------------------------------               Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:K -----------------------------------------------------               Crystal structure of bovine mitochondrial cytochrome bc1  ...
1be3:K*-----------------------------------------------------            ×3 Cytochrome bc1 complex from bovine
3wc3:A -----------------------------------------------------               Crystal structure of endo-1,4-beta-glucanase from eisenia fe
1orv:A*qqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshflkqcfslp            ×8 Crystal structure of porcine dipeptidyl peptidase iv (cd26)
4ifd:I -----------------------------------------------------               Crystal structure of an 11-subunit eukaryotic exosome  ...
3mgb:A -----------------------------------------------------               Teg 12 ternary structure complexed with pap and the  ...
1xp2:A*-----------------------------------------------------            ×2 Crystal structure of the enzymatically active domain of the  ...
3r40:A -----------------------------------------------------               Crystal structure of the fluoroacetate dehalogenase rpa1163  ...
3reb:A -----------------------------------------------------               HIV-1 nef protein in complex with engineered hck-sh3 domain
3bxt:A*-----------------------------------------------------            ×3 Crystal structure of sc4828, a unique phosphatase from  ...
3reb:C -----------------------------------------------------               HIV-1 nef protein in complex with engineered hck-sh3 domain
2vat:A -----------------------------------------------------               Crystal structure of deacetylcephalosporin c  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P07552. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

z-score E-
Protein name
1. - - - 56 - - P07552 Cytochrome b-c1 complex subunit 10 OS=Bos taurus GN=UQCR11 PE=1 SV=2
2. 389 100.0% 54 54 605.8 9.2e-27 1sqq:K Crystal structure analysis of bovine bc1 with methoxy acryla stilbene (moas)
3. 383 100.0% 53 53 596.8 2.9e-26 1sqx:K * Crystal structure analysis of bovine bc1 with stigmatellin a
4. " " " " " "  = 2fyu:K *
Crystal structure of bovine heart mitochondrial bc1 with jg1 inhibitor
5. 378 98.1% 53 53 589.2 7.6e-26 1l0l:K * Structure of bovine mitochondrial cytochrome bc1 complex wit fungicide famoxadone
6. " " " " " "  = 1ntk:K *
Crystal structure of mitochondrial cytochrome bc1 in complex antimycin a1
7. " " " " " "  = 1ntz:K *
Crystal structure of mitochondrial cytochrome bc1 complex bo ubiquinone
8. " " " " " "  = 1nu1:K *
Crystal structure of mitochondrial cytochrome bc1 complexed nonyl-4-hydroxyquinoline n-oxide (nqno)
9. 378 98.1% 53 53 589.2 7.6e-26 1sqp:K Crystal structure analysis of bovine bc1 with myxothiazol
10. 369 100.0% 51 51 575.9 4.2e-25 1sqv:K Crystal structure analysis of bovine bc1 with uhdbt
11. 364 98.0% 51 51 568.3 1.1e-24 1ntm:K Crystal structure of mitochondrial cytochrome bc1 complex at angstrom
12. 352 96.2% 52 52 550.0 1.2e-23 1sqb:K Crystal structure analysis of bovine bc1 with azoxystrobin
13. 302 91.8% 49 49 474.6 1.8e-19 1l0n:K Native structure of bovine mitochondrial cytochrome bc1 comp
14. 282 93.3% 45 45 444.9 8.3e-18 1qcr:K Crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only
15. 134 90.9% 22 22 225.9 1.3e-05 1be3:K * Cytochrome bc1 complex from bovine
16. " " " " " "  = 1bgy:K *
Cytochrome bc1 complex from bovine
17. " " " " " "  = 2ybb:K *
Fitted model for bovine mitochondrial supercomplex i1iii2iv single particle cryo-em (emd-1876)
18. 84 38.9% 36 435 128.1 3.7 3wc3:A Crystal structure of endo-1,4-beta-glucanase from eisenia fe
19. 82 36.4% 44 728 121.3 8.8 1orv:A * Crystal structure of porcine dipeptidyl peptidase iv (cd26)
20. " " " " " "  = 1orw:A *
Crystal structure of porcine dipeptidyl peptidase iv (cd26) with a peptidomimetic inhibitor
21. " " " " " "  = 2aj8:A *
Porcine dipeptidyl peptidase iv (cd26) in complex with 7-ben dimethyl-8-piperazin-1-yl-3,7-dihydro-purine-2,6-dione (bdp
22. " " " " " "  = 2ajb:A *
Porcine dipeptidyl peptidase iv (cd26) in complex with the t tert-butyl-gly-l-pro-l-ile (tbu-gpi)
23. " " " " " "  = 2ajc:A *
Porcine dipeptidyl peptidase iv (cd26) in complex with 4-(2- aminoethyl)-benzene sulphonyl fluoride (aebsf)
24. " " " " " "  = 2ajd:A *
Porcine dipeptidyl peptidase iv (cd26) in complex with l-pro pro (boropro)
25. " " " " " "  = 2bua:A *
Crystal structure of porcine dipeptidyl peptidase iv (cd26) in complex with a low molecular weight inhibitor.
26. " " " " " "  = 2buc:A *
Crystal structure of porcine dipeptidyl peptidase iv (cd26) in complex with a tetrahydroisoquinoline inhibitor
27. 75 36.4% 44 230 119.2 12 4ifd:I Crystal structure of an 11-subunit eukaryotic exosome comple RNA
28. 74 28.0% 50 286 116.1 17 3mgb:A Teg 12 ternary structure complexed with pap and the teicopla aglycone
29. 70 34.4% 32 149 114.8 20 1xp2:A * Crystal structure of the enzymatically active domain of the listeria monocytogenes bacteriophage 500 endolysin ply500
30. " " " " " "  = 2vo9:A *
Crystal structure of the enzymatically active domain of the listeria monocytogenes bacteriophage 500 endolysin ply500
31. 72 37.1% 35 291 112.9 26 3r40:A Crystal structure of the fluoroacetate dehalogenase rpa1163 asp110asn/apo
32. 65 38.5% 26 106 109.7 39 3reb:A HIV-1 nef protein in complex with engineered hck-sh3 domain
33. 68 32.1% 53 210 109.2 41 3bxt:A * Crystal structure of sc4828, a unique phosphatase from streptomyces coelicolor
34. " " " " " "  = 3cbt:A *
Crystal structure of sc4828, a unique phosphatase from streptomyces coelicolor
35. " " " " " "  = 3exm:A *
Crystal structure of the phosphatase sc4828 with the non-hyd nucleotide gpcp
36. 65 38.5% 26 114 109.2 42 3reb:C HIV-1 nef protein in complex with engineered hck-sh3 domain
37. 70 30.8% 52 347 108.6 45 2vat:A Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a

Number of sequences: 37

Excluded sequences

z-score E-
Protein name
1. 70 30.8% 52 346 108.6 45 2vax:A Crystal structure of deacetylcephalosporin c acetyltransferase (cephalosporin c-soak)
2. 65 38.5% 26 123 108.6 45 3rbb:C HIV-1 nef protein in complex with engineered hck sh3 domain
3. 70 30.8% 52 347 108.5 45 2vav:A Crystal structure of deacetylcephalosporin c acetyltransferase (dac-soak)
4. 65 38.5% 26 125 108.5 45 3rea:C HIV-1 nef protein in complex with engineered hck-sh3 domain
5. 65 38.5% 26 127 108.4 46 3rea:A HIV-1 nef protein in complex with engineered hck-sh3 domain
6. 67 45.5% 33 207 107.8 50 3cvg:C Crystal structure of a periplasmic putative metal binding pr
7. 65 38.5% 26 137 107.8 50 3rbb:A HIV-1 nef protein in complex with engineered hck sh3 domain

Number of sequences: 7

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

