spacer
spacer

SAS results for UniProt accession no. P00129

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P00129 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P00129 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 31 unique sequences (including 8 consensus sequences) giving 62 sequence matches in all. The 12 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00129 -----------------------------------------------------------------    Cytochrome b-c1 complex subunit 7 OS=Bos taurus GN=UQCRB  ...
1l0l:F -----------------------------------------------------------------    Structure of bovine mitochondrial cytochrome bc1 complex  ...
1be3:F*-----------------------------------------------------------------×3  Cytochrome bc1 complex from bovine
1l0n:F*-----------------------------------------------------------------×9  Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:F -----------------------------------------------------------------    Crystal structure of bovine mitochondrial cytochrome bc1  ...
1sqp:F -----------------------------------------------------------------    Crystal structure analysis of bovine bc1 with myxothiazol
1pp9:F*-----------------------------------------------------------------×4  Bovine cytochrome bc1 complex with stigmatellin bound
1bcc:F*-----------------------------------------------------------------×3  Cytochrome bc1 complex from chicken
3h1h:F*-----------------------------------------------------------------×11 Cytochrome bc1 complex from chicken
3h1l:F -----------------------------------------------------------------    Chicken cytochrome bc1 complex with ascochlorin bound at qo  ...
3cwb:F -----------------------------------------------------------------    Chicken cytochrome bc1 complex inhibited by an iodinated  ...
1ezv:F*-----------------------------------------------------------------×5  Structure of the yeast cytochrome bc1 complex co-  ...
3cx5:G -----------------------------------------------------------------    Structure of complex iii with bound cytochromE C in reduced  ...
3cxh:G -----------------------------------------------------------------    Structure of yeast complex iii with isoform-2 cytochromE C  ...
2nl9:A*-----------------------------------------------------------------×2  Crystal structure of the mcl-1:bim bh3 complex
3d7v:A ---------------------------------------------------------------dd    Crystal structure of mcl-1 in complex with an mcl-1  ...
2nla:A --------------------------------------------------------ddlyrqsle    Crystal structure of the mcl-1:mnoxab bh3 complex
2xze:A -----------------------------------------------------------------    Structural basis for amsh-escrt-iii chmp3 interaction
3iyr:B ----apvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiap    Tmrna-smpb: a journey to the center of the bacterial ribosom
4abr:2 ---mapvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiap    Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin  ...
3w6g:A vvigekfpevevktthgviklpdyftkqgkwfilfshpadftpvcttefygmqkrveefrklgve    Structure of peroxiredoxin from anaerobic hyperthermophilic  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P00129 -----------------------magrpavsassrwlegirkwyynaagfnk--lglmrddtihe    Cytochrome b-c1 complex subunit 7 OS=Bos taurus GN=UQCRB  ...
1l0l:F -------------------------grpavsassrwlegirkwyynaagfnk--lglmrddtihe    Structure of bovine mitochondrial cytochrome bc1 complex  ...
1be3:F*----------------------------avsassrwlegirkwyynaagfnk--lglmrddtihe×3  Cytochrome bc1 complex from bovine
1l0n:F*-----------------------------vsassrwlegirkwyynaagfnk--lglmrddtihe×9  Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:F -------------------------------assrwlegirkwyynaagfnk--lglmrddtihe    Crystal structure of bovine mitochondrial cytochrome bc1  ...
1sqp:F -----------------------------VSASSRWLEKIRKWYYNAAGFNK--LGLMRDDTIHE    Crystal structure analysis of bovine bc1 with myxothiazol
1pp9:F*-----------------------------------WLEGIRKWYYNAAGFNK--LGLMRDDTIHE×4  Bovine cytochrome bc1 complex with stigmatellin bound
1bcc:F*---------------------------------SRWLEGIRKWYYNAAGFNK--YGLMRDDTIYE×3  Cytochrome bc1 complex from chicken
3h1h:F*---------------------------------GRLMDRIRKWYYNAAGFNK--YGLMRDDTLYE×11 Cytochrome bc1 complex from chicken
3h1l:F ---------------------------------GRLMDRIRKWYYNAAGFNK--YGLMRDDTLYE    Chicken cytochrome bc1 complex with ascochlorin bound at qo  ...
3cwb:F ---------------------------------GRLMDRIRKWYYNAAGFNK--YGLMRDDTLYE    Chicken cytochrome bc1 complex inhibited by an iodinated  ...
1ezv:F*--------------QSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKK--LGLKFDDLIAE×5  Structure of the yeast cytochrome bc1 complex co-  ...
3cx5:G -------------PQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKK--LGLKFDDLIAE    Structure of complex iii with bound cytochromE C in reduced  ...
3cxh:G --------------QSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKK--LGLKFDDLIAE    Structure of yeast complex iii with isoform-2 cytochromE C  ...
2nl9:A*ddlyrqsleiisrylreqatgsgaagrraletlrrvgdgvqrnheta--fq----gmlrkldikn×2  Crystal structure of the mcl-1:bim bh3 complex
3d7v:A lyrqsleiisrylreqatgskdgaagrraletlrrvgdgvqrnheta--fq----gmlrkldikn    Crystal structure of mcl-1 in complex with an mcl-1  ...
2nla:A iisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnheta--fq----gmlrkldikn    Crystal structure of the mcl-1:mnoxab bh3 complex
2xze:A -sdhgdvslppedrvralsqlgsavevnedipprryfrsgveiirmasiyse--egniehafily    Structural basis for amsh-escrt-iii chmp3 interaction
3iyr:B yekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargkkaye    Tmrna-smpb: a journey to the center of the bacterial ribosom
4abr:2 yekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargkkaye    Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin  ...
3w6g:A piglsvdqvfshikwiewikdnlsveidfpviaddrgelaeklgmipsgati--taravfvvddk    Structure of peroxiredoxin from anaerobic hyperthermophilic  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P00129 n--ddv-keairrlpenl-yndrvfrikraldlsmrqqilpkeqwtkyee--dksylepylkevi    Cytochrome b-c1 complex subunit 7 OS=Bos taurus GN=UQCRB  ...
1l0l:F n--ddv-keairrlpenl-yddrvfrikraldlsmrqqilpkeqwtkyee--dksylepylkevi    Structure of bovine mitochondrial cytochrome bc1 complex  ...
1be3:F*n--ddv-keairrlpenl-yddrvfrikraldlsmrqqilpkeqwtkyee--dksylepylkevi×3  Cytochrome bc1 complex from bovine
1l0n:F*n--ddv-keairrlpenl-yddrvfrikraldlsmrqqilpkeqwtkyee--dksylepylkevi×9  Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:F n--ddv-keairrlpenl-yddrvfrikraldlsmrqqilpkeqwtkyee--dksylepylkevi    Crystal structure of bovine mitochondrial cytochrome bc1  ...
1sqp:F N--DDV-KEAIRRLPENL-YDDRVFRIKRALDLSMRQQILPKEQWTKYEE--DKSYLEPYLKEVI    Crystal structure analysis of bovine bc1 with myxothiazol
1pp9:F*N--DDV-KEAIRRLPENL-YDDRVFRIKRALDLSMRQQILPKEQWTKYEE--DKSYLEPYLKEVI×4  Bovine cytochrome bc1 complex with stigmatellin bound
1bcc:F*N--DDV-KEAIRRLPENL-YDDRMFRIKRALDLNMRQQILPKEQWTKYEE--DVPYLEPYLKEVI×3  Cytochrome bc1 complex from chicken
3h1h:F*D--DDV-KEALKRLPEDL-YNERMFRIKRALDLSLKHRILPKEQWVKYEE--DKPYLEPYLKEVI×11 Cytochrome bc1 complex from chicken
3h1l:F D--DDV-KEALKRLPKDL-YNERMFRIKRALDLSLKHRILPKEQWVKYEE--DKPYLEPYLKEVI    Chicken cytochrome bc1 complex with ascochlorin bound at qo  ...
3cwb:F D--DDV-KEALKRLPKDL-YNERMFRIKRALDLSLKHRILPKEQWVKYEE--DKPYLEPYLKEVI    Chicken cytochrome bc1 complex inhibited by an iodinated  ...
1ezv:F*E--NPIMQTALRRLPEDE-SYARAYRIIRAHQTELTHHLLPRNEWIKAQE--DVPYLLPYILEAE×5  Structure of the yeast cytochrome bc1 complex co-  ...
3cx5:G E--NPIMQTALRRLPEDE-SYARAYRIIRAHQTELTHHLLPRNEWIKAQE--DVPYLLPYILEAE    Structure of complex iii with bound cytochromE C in reduced  ...
3cxh:G E--NPIMQTALRRLPEDE-SYARAYRIIRAHQTELTHHLLPRNEWIKAQE--DVPYLLPYILEAE    Structure of yeast complex iii with isoform-2 cytochromE C  ...
2nl9:A*e--ddv-k-slsrvmihv-fsdgvtnwgrivtlisfgafvakhlktinqe----sciep-laesi×2  Crystal structure of the mcl-1:bim bh3 complex
3d7v:A e--ddv-k-slsrvmihv-fsdgvtnwgrivtlisfgafvakhlktinqe----sciep-laesi    Crystal structure of mcl-1 in complex with an mcl-1  ...
2nla:A e--ddv-k-slsrvmihv-fsdgvtnwgrivtlisfgafvakhlktinqe----sciep-laesi    Crystal structure of the mcl-1:mnoxab bh3 complex
2xze:A n--kyi-tlfieklpkhrdyksavipekkdtvkklkeiafpkaeelkael--lkrytkeyteyne    Structural basis for amsh-escrt-iii chmp3 interaction
3iyr:B krredk-keavrraleel-----------------------------------------------    Tmrna-smpb: a journey to the center of the bacterial ribosom
4abr:2 krredk-keavrraleel-----------------------------------------------    Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin  ...
3w6g:A g--iir-aivyypaevgr-dwdeilrlvkalkistekgvalphkwpnneligdkvivpp--asti    Structure of peroxiredoxin from anaerobic hyperthermophilic  ...

           2         2         2    
           0         1         2    
       67890123456789012345678901234                                        Protein name
       ----+---------+---------+----                                        ------------
P00129 rer--kereewakk---------------                                        Cytochrome b-c1 complex subunit 7 OS=Bos taurus GN=UQCRB  ...
1l0l:F rer--kereewakk---------------                                        Structure of bovine mitochondrial cytochrome bc1 complex  ...
1be3:F*rer--kereewakk---------------                                    ×3  Cytochrome bc1 complex from bovine
1l0n:F*rer--kereewakk---------------                                    ×9  Native structure of bovine mitochondrial cytochrome bc1 comp
1qcr:F rer--kereewakk---------------                                        Crystal structure of bovine mitochondrial cytochrome bc1  ...
1sqp:F RER--KEREEWAKK---------------                                        Crystal structure analysis of bovine bc1 with myxothiazol
1pp9:F*RER--KEREEWAKK---------------                                    ×4  Bovine cytochrome bc1 complex with stigmatellin bound
1bcc:F*RER--KEREEWDK----------------                                    ×3  Cytochrome bc1 complex from chicken
3h1h:F*RER--LEREAWNKK---------------                                    ×11 Cytochrome bc1 complex from chicken
3h1l:F RER--LEREAWNKK---------------                                        Chicken cytochrome bc1 complex with ascochlorin bound at qo  ...
3cwb:F RER--LEREAWNK----------------                                        Chicken cytochrome bc1 complex inhibited by an iodinated  ...
1ezv:F*AAA--KEKDELDNIEVSK-----------                                    ×5  Structure of the yeast cytochrome bc1 complex co-  ...
3cx5:G AAA--KEKDELDNIEVSK-----------                                        Structure of complex iii with bound cytochromE C in reduced  ...
3cxh:G AAA--KEKDELDNIEVSK-----------                                        Structure of yeast complex iii with isoform-2 cytochromE C  ...
2nl9:A*tdvlvrtkrdwlvkqrgwdgfveffhve-                                    ×2  Crystal structure of the mcl-1:bim bh3 complex
3d7v:A tdvlvrtkrdwlvkqrgwdgfveffhve-                                        Crystal structure of mcl-1 in complex with an mcl-1  ...
2nla:A tdvlvrtkrdwlvkqrgwdgfveffhv--                                        Crystal structure of the mcl-1:mnoxab bh3 complex
2xze:A ekk--keaeelarnmaiqqel--------                                        Structural basis for amsh-escrt-iii chmp3 interaction
3iyr:B -----------------------------                                        Tmrna-smpb: a journey to the center of the bacterial ribosom
4abr:2 -----------------------------                                        Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin  ...
3w6g:A eek--kqreeakakgeiecydwwfcykkl                                        Structure of peroxiredoxin from anaerobic hyperthermophilic  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P00129. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 111 - - P00129 Cytochrome b-c1 complex subunit 7 OS=Bos taurus GN=UQCRB PE=1 SV=3
2. 732 99.1% 109 109 941.7 1.8e-45 1l0l:F Structure of bovine mitochondrial cytochrome bc1 complex wit fungicide famoxadone
3. 707 99.1% 106 106 910.1 1e-43 1be3:F * Cytochrome bc1 complex from bovine
4. " " " " " "  = 1bgy:F *
Cytochrome bc1 complex from bovine
5. " " " " " "  = 2fyu:F *
Crystal structure of bovine heart mitochondrial bc1 with jg1 inhibitor
6. 702 99.0% 105 105 903.8 2.2e-43 1l0n:F * Native structure of bovine mitochondrial cytochrome bc1 comp
7. " " " " " "  = 1ntk:F *
Crystal structure of mitochondrial cytochrome bc1 in complex antimycin a1
8. " " " " " "  = 1ntm:F *
Crystal structure of mitochondrial cytochrome bc1 complex at angstrom
9. " " " " " "  = 1ntz:F *
Crystal structure of mitochondrial cytochrome bc1 complex bo ubiquinone
10. " " " " " "  = 1nu1:F *
Crystal structure of mitochondrial cytochrome bc1 complexed nonyl-4-hydroxyquinoline n-oxide (nqno)
11. " " " " " "  = 1sqb:F *
Crystal structure analysis of bovine bc1 with azoxystrobin
12. " " " " " "  = 1sqq:F *
Crystal structure analysis of bovine bc1 with methoxy acryla stilbene (moas)
13. " " " " " "  = 1sqv:F *
Crystal structure analysis of bovine bc1 with uhdbt
14. " " " " " "  = 1sqx:F *
Crystal structure analysis of bovine bc1 with stigmatellin a
15. 692 99.0% 103 103 891.3 1.1e-42 1qcr:F Crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only
16. 692 98.1% 105 105 891.1 1.1e-42 1sqp:F Crystal structure analysis of bovine bc1 with myxothiazol
17. 670 99.0% 99 99 863.6 3.9e-41 1pp9:F * Bovine cytochrome bc1 complex with stigmatellin bound
18. " " " " " "  = 1ppj:F *
Bovine cytochrome bc1 complex with stigmatellin and antimyci
19. " " " " " "  = 2a06:F *
Bovine cytochrome bc1 complex with stigmatellin bound
20. " " " " " "  = 2ybb:F *
Fitted model for bovine mitochondrial supercomplex i1iii2iv single particle cryo-em (emd-1876)
21. 632 92.0% 100 100 815.3 1.9e-38 1bcc:F * Cytochrome bc1 complex from chicken
22. " " " " " "  = 2bcc:F *
Stigmatellin-bound cytochrome bc1 complex from chicken
23. " " " " " "  = 3bcc:F *
Stigmatellin and antimycin bound cytochrome bc1 complex from
24. 551 78.0% 100 101 712.4 1e-32 3h1h:F * Cytochrome bc1 complex from chicken
25. " " " " " "  = 3h1i:F *
Stigmatellin and antimycin bound cytochrome bc1 complex from
26. " " " " " "  = 3h1j:F *
Stigmatellin-bound cytochrome bc1 complex from chicken
27. " " " " " "  = 3h1k:F *
Chicken cytochrome bc1 complex with zn++ and an iodinated de of kresoxim-methyl bound
28. " " " " " "  = 3l70:F *
Cytochrome bc1 complex from chicken with trifloxystrobin bound
29. " " " " " "  = 3l71:F *
Cytochrome bc1 complex from chicken with azoxystrobin bound
30. " " " " " "  = 3l72:F *
Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
31. " " " " " "  = 3l73:F *
Cytochrome bc1 complex from chicken with triazolone inhibitor
32. " " " " " "  = 3l74:F *
Cytochrome bc1 complex from chicken with famoxadone bound
33. " " " " " "  = 3l75:F *
Cytochrome bc1 complex from chicken with fenamidone bound
34. " " " " " "  = 3tgu:F *
Cytochrome bc1 complex from chicken with pfvs-designed moa i bound
35. 546 77.0% 100 101 706.0 2.3e-32 3h1l:F Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
36. 540 76.8% 99 100 698.5 6.1e-32 3cwb:F Chicken cytochrome bc1 complex inhibited by an iodinated ana the polyketide crocacin-d
37. 228 39.1% 92 125 300.9 8.6e-10 1ezv:F * Structure of the yeast cytochrome bc1 complex co- crystallized with an antibody fv-fragment
38. " " " " " "  = 1kb9:G *
Yeast cytochrome bc1 complex
39. " " " " " "  = 1kyo:G *
Yeast cytochrome bc1 complex with bound substrate cytochromE C
40. " " " " " "  = 1p84:G *
Hdbt inhibited yeast cytochrome bc1 complex
41. " " " " " "  = 2ibz:F *
Yeast cytochrome bc1 complex with stigmatellin
42. 228 39.1% 92 126 300.9 8.6e-10 3cx5:G Structure of complex iii with bound cytochromE C in reduced definition of a minimal core interface for electron transfe
43. 228 39.1% 92 125 300.9 8.6e-10 3cxh:G Structure of yeast complex iii with isoform-2 cytochromE C b definition of a minimal core interface for electron transfe
44. 87 27.7% 112 142 121.1 8.9 2nl9:A * Crystal structure of the mcl-1:bim bh3 complex
45. " " " " " "  = 3io9:A *
Biml12y in complex with mcl-1
46. 87 27.7% 112 144 121.0 9.1 3d7v:A Crystal structure of mcl-1 in complex with an mcl-1 selective bh3 ligand
47. 87 27.7% 112 150 120.7 9.4 2nla:A Crystal structure of the mcl-1:mnoxab bh3 complex
48. 83 25.0% 88 141 116.0 17 2xze:A Structural basis for amsh-escrt-iii chmp3 interaction
49. 83 43.9% 41 143 115.9 17 3iyr:B Tmrna-smpb: a journey to the center of the bacterial ribosom
50. 83 43.9% 41 144 115.9 17 4abr:2 Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin with the 70s ribosome
51. 84 30.4% 56 214 114.5 21 3w6g:A Structure of peroxiredoxin from anaerobic hyperthermophilic pyrococcus horikoshii

Number of sequences: 51

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 76 28.8% 52 58 113.1 25 3r93:A Crystal structure of the chromo domain of m-phase phosphopro bound to h3k9me3 peptide
2. 76 28.8% 52 59 112.9 25 3r93:D Crystal structure of the chromo domain of m-phase phosphopro bound to h3k9me3 peptide
3. 76 28.8% 52 60 112.8 26 3svm:A Human mpp8 - human dnmt3ak47me2 peptide
4. 76 28.8% 52 61 112.7 26 3lwe:A The crystal structure of mpp8
5. 76 28.8% 52 61 112.7 26 3qo2:A Structural insights for mpp8 chromodomain interaction with h lysine 9
6. 84 34.3% 35 306 112.1 28 1clt:M Photosynthetic reaction center, theoretical model
7. 80 26.4% 72 148 111.9 29 2dbo:A Crystal structure of d-tyr-tRNA(tyr) deacylase from aquifex
8. 77 32.1% 53 109 110.1 36 2q97:T Complex of mammalian actin with toxofilin from toxoplasma go
9. 85 24.1% 87 549 109.5 39 3px4:A Crystal structure of bacillus DNA polymerase i large fragmen DNA and ddctp-da mismatch (wobble) in ajar conformation
10. 81 26.2% 80 321 108.0 48 1y0z:A * X-ray structure of gene product from arabidopsis thaliana at
11. " " " " " "  = 2q4a:A *
Ensemble refinement of the protein crystal structure of gene from arabidopsis thaliana at3g21360
12. 72 37.0% 46 59 107.9 49 3kka:C Co-crystal structure of the sam domains of epha1 and epha2

Number of sequences: 12

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer