spacer
spacer

SAS results for UniProt accession no. P04716

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P04716 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P04716 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 52 unique sequences (including 12 consensus sequences) giving 84 sequence matches in all. The 51 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P04716 msmktlp--k--e--rrfetfsylpplsdrqiaaqieymieqgfhplief---------n-----   Ribulose bisphosphate carboxylase small chain  ...
1rsc:M -smktlp--k--e--rrfetfsylpplsdrqiaaqieymieqgfhplief---------n-----   Structure of an effector induced inactivated state of  ...
1rbl:M -smktlp--k--e--rrfetfsylpplsdrqiaaqieymieqgfhplief---------n-----   Structure determination and refinement of ribulose 1,5  ...
2ybv:B ----tlp--k--e--rryetfsylpplsdaqiarqiqyaidqgyhpcvef---------n-----   Structure of rubisco from thermosynechococcus elongatus
3zxw:B ---------------------sylpplsdaqiarqiqyaidqgyhpcvef---------n-----   Structure of activated rubisco from thermosynechococcus  ...
1uzh:C MMVWTPV--N--N--KMFETFSYLPPLTDEQIAAQVDYIVANGWIPCLEF---------A-----   A chimeric chlamydomonas, synechococcus rubisco enzyme
1svd:M -EMQDYK--Q--S--LKYETFSYLPPMNAERIRAQIKYAIAQGWSPGIEH---------V-----   The structure of halothiobacillus neapolitanus rubisco
1bwv:S ---------v--r--itqgtfsflpdltdeqikkqidymiskklaigiey---------t-----   Activated ribulose 1,5-bisphosphate carboxylase/oxygenase  ...
1iwa:B ---------m--r--itqgtfsflpdltdeqikkqidymiskklaigiey---------t-----   Rubisco from galdieria partita
1ir1:S --xkvwp--t--qnmkryetlsylpplttdqlarqvdyllnnkwvpclef---------etdhgf   Crystal structure of spinach ribulose-1,5-bisphosphate  ...
1bur:S mqvwpil--g--m--kkyetlsylppltteqllaevnyllvnnwipclef---------evkdgf   Ribulose 1,5-bisphosphate carboxylase/oxygenase complexed  ...
4f0h:B*---------M--R--ITQGTFSFLPDLTDEQIKKQIDYMISKKLAIGIEY---------T-----×3 Unactivated rubisco with oxygen bound
1aa1:S*mqvwpil--n--l--kkyetlsylpplttdqlarqvdyllnnkwvpclef---------etdhgf×9 Activated spinach rubisco in complex with the product 3-  ...
1bxn:I ---------m--r--itqgtfsflpeltdeqitkqleyclnqgwavgley---------t-----   The crystal structure of rubisco from alcaligenes eutrophus  ...
8rub:S mqvwpil--g--l--kkfetlsylppltteqllaevnyllvkgwipclef---------evkdgf   Lyase(carbon-carbon)
1uzd:C MMVWTPV--N--N--KMFETFSYLPPLTDEQIAAQVDYIVANGWIPCLEFATDHGFVYRE-----   Chlamydomonas,spinach chimeric rubisco
4hhh:S --mqvwp--pigk--kkfetlsylppltrdqllkeveyllrkgwvpclef---------elkkgf   Structure of pisum sativum rubisco
1ej7:S*--mqvwppin--k--kkyetlsylpdlsqeqllseveyllkngwvpclef---------et----×4 Crystal structure of unactivated tobacco rubisco with bound  ...
4rub:S --mqvwppin--k--kkyetlsylpdlsqeqllseveyllkngwvpclef---------et----   A crystal form of ribulose-1,5-bisphosphate  ...
1wdd:S xqvwpie--g--i--kkfetlsylppltvedllkqieyllrskwvpclef---------s-----   Crystal structure of activated rice rubisco complexed with  ...
3axk:S -xmqvwp--i--egikkfetlsylppltvedllkqieyllrskwvpclef---------s-----   Structure of rice rubisco in complex with NADP(h)

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P04716 ---e--------h-s--------npeef---y----wtmwklplfdckspqqvldevrecrseyg   Ribulose bisphosphate carboxylase small chain  ...
1rsc:M ---e--------h-s--------npeef---y----wtmwklplfdckspqqvldevrecrseyg   Structure of an effector induced inactivated state of  ...
1rbl:M ---e--------h-s--------npeef---y----wtmwklplfacaapqqvldevrecrseyg   Structure determination and refinement of ribulose 1,5  ...
2ybv:B ---e--------t-s--------naeir---y----wtmwklplfnctnaqdvlnevqqcrseyp   Structure of rubisco from thermosynechococcus elongatus
3zxw:B ---e--------t-s--------naeir---y----wtmwklplfnctnaqdvlnevqqcrseyp   Structure of activated rubisco from thermosynechococcus  ...
1uzh:C ---E--------H-S--------NPEEF---Y----WTMWKLPMFGCRDPMQVLREIVACTKAFP   A chimeric chlamydomonas, synechococcus rubisco enzyme
1svd:M ---E--------V-K--------NSMNQ---Y----WYMWKLPFFGEQNVDNVLAEIEACRSAYP   The structure of halothiobacillus neapolitanus rubisco
1bwv:S ---n--------d-i--------hprna---y----weiwglplfdvtdpaavlfeinacrkars   Activated ribulose 1,5-bisphosphate carboxylase/oxygenase  ...
1iwa:B ---n--------d-i--------hprna---y----weiwglplfdvtdpaavlfeinacrkars   Rubisco from galdieria partita
1ir1:S vyre--------h-h--------nspgy---ydgrywtmwklpmfgctdpaqvlneleeckkeyp   Crystal structure of spinach ribulose-1,5-bisphosphate  ...
1bur:S vyre--------hlk--------spgyydgry----wtmwklpmfgctdpaqvlneleeckkayp   Ribulose 1,5-bisphosphate carboxylase/oxygenase complexed  ...
4f0h:B*---N--------D-I--------HPRNS---F----WEMWGLPLFEVTDPAPVLFEINACRKAKS×3 Unactivated rubisco with oxygen bound
1aa1:S*vyre--------h-h--------nspgy---ydgrywtmwklpmfgctdpaqvlneleeckkeyp×9 Activated spinach rubisco in complex with the product 3-  ...
1bxn:I ---d--------d-p--------hprnt---y----wemfglpmfdlrdaagilmeinnarntfp   The crystal structure of rubisco from alcaligenes eutrophus  ...
8rub:S vyre--------h-dk-------spgyydgry----wtmwklpmfgctdpaqvvneveevkkayp   Lyase(carbon-carbon)
1uzd:C ---H--------H-N--------SPGYYDGRY----WTMWKLPMFGCRDPMQVLREIVACTKAFP   Chlamydomonas,spinach chimeric rubisco
4hhh:S vyre--------h-nk-------spgyydgry----wtmwklpmfgttdpaqvlkeldevkkeyp   Structure of pisum sativum rubisco
1ej7:S*---e--------h-gfvyrennkspgyydgry----wtmwklpmfgctdatqvlaeveeakkayp×4 Crystal structure of unactivated tobacco rubisco with bound  ...
4rub:S ---e--------h-gfvyrennkspgyydgry----wtmwklpmfgctdatqvlaevgeakkayp   A crystal form of ribulose-1,5-bisphosphate  ...
1wdd:S ---kvgfvyrenh-r--------spgyydgry----wtmwklpmfgctdatqvlkeleeakkayp   Crystal structure of activated rice rubisco complexed with  ...
3axk:S ---kvgfvyrenh-r--------spgyydgry----wtmwklpmfgctdatqvlkeleeakkayp   Structure of rice rubisco in complex with NADP(h)

                1         1         1         1         1         1    
                4         5         6         7         8         9    
       1234567890123456789012345678901234567890123456789012345678901234    Protein name
       ---------+---------+---------+---------+---------+---------+----    ------------
P04716 dcyirvagfdnikqcqt--v--sfivhrpgry--------------------------------    Ribulose bisphosphate carboxylase small chain  ...
1rsc:M dcyirvagfdnikecqt--v--sfivhrpgr---------------------------------    Structure of an effector induced inactivated state of  ...
1rbl:M dcyirvagfdnikecqt--s--sfivhrpgr---------------------------------    Structure determination and refinement of ribulose 1,5  ...
2ybv:B ncfirvvafdnikqcqv--m--sfivykp-----------------------------------    Structure of rubisco from thermosynechococcus elongatus
3zxw:B ncfirvvafdnikqcqv--m--sfivykp-----------------------------------    Structure of activated rubisco from thermosynechococcus  ...
1uzh:C DAYVRLVAFDNQKQVQI--M--GFLVQRPKTARDFQPANKRSV---------------------    A chimeric chlamydomonas, synechococcus rubisco enzyme
1svd:M THQVKLVAYDNYAQSLG--L--AFVVYRGN----------------------------------    The structure of halothiobacillus neapolitanus rubisco
1bwv:S nfyikvvgfssvrgiestii--sfivnrpkhepgfnlmrqedksrsikytihsyesykpedery    Activated ribulose 1,5-bisphosphate carboxylase/oxygenase  ...
1iwa:B nfyikvvgfssvrgiestii--sfivnrpkhepgfnlmrqedksrsikytihsyesykpedery    Rubisco from galdieria partita
1ir1:S nafiriigfdsnrqvqc--v--sfiaykpag---------------------------------    Crystal structure of spinach ribulose-1,5-bisphosphate  ...
1bur:S dafiriigfdnkrqvqc--i--sfiaykpagy--------------------------------    Ribulose 1,5-bisphosphate carboxylase/oxygenase complexed  ...
4f0h:B*NFYIKVVGFSSERGIESTII--SFIVNRPKHEPGFNLIRQEDKSRSIKYSIQAYETYKPEDQRY ×3 Unactivated rubisco with oxygen bound
1aa1:S*nafiriigfdsnrevqc--i--sfiaykpagy-------------------------------- ×9 Activated spinach rubisco in complex with the product 3-  ...
1bxn:I nhyirvtafdsthtves--vvmsfivnrpadepgfrlvrqeepgrtlrysiesya---------    The crystal structure of rubisco from alcaligenes eutrophus  ...
8rub:S dafvriigfdnkrqvqc--i--sfiaykpagy--------------------------------    Lyase(carbon-carbon)
1uzd:C DAYVRLVAFDNQKQVQI--M--GFLVQRPKQPANKRSV--------------------------    Chlamydomonas,spinach chimeric rubisco
4hhh:S rafvrvigfnnvrqvqc--i--sfiahtpesy--------------------------------    Structure of pisum sativum rubisco
1ej7:S*qawiriigfdnvrqvqc--i--sfiaykpegy-------------------------------- ×4 Crystal structure of unactivated tobacco rubisco with bound  ...
4rub:S qawiriigfdnvrqvqc--i--sfiaykpegy--------------------------------    A crystal form of ribulose-1,5-bisphosphate  ...
1wdd:S dafvriigfdnvrqvql--i--sfiaykppg---------------------------------    Crystal structure of activated rice rubisco complexed with  ...
3axk:S dafvriigfdnvrqvqc--i--sfiaykp-----------------------------------    Structure of rice rubisco in complex with NADP(h)

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P04716. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 111 - - P04716 Ribulose bisphosphate carboxylase small chain OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cbbS PE=1 SV=3
2. 771 99.1% 109 109 1001.3 8.4e-49 1rsc:M Structure of an effector induced inactivated state of ribulo bisphosphate carboxylase(slash)oxygenase: the binary comple enzyme and xylulose bisphosphate
3. 743 95.4% 109 109 965.3 8.4e-47 1rbl:M Structure determination and refinement of ribulose 1,5 bisph carboxylase(slash)oxygenase from synechococcus pcc6301
4. 546 71.2% 104 104 712.9 9.7e-33 2ybv:B Structure of rubisco from thermosynechococcus elongatus
5. 477 68.8% 93 93 625.1 7.5e-28 3zxw:B Structure of activated rubisco from thermosynechococcus elon complexed with 2-carboxyarabinitol-1,5-diphosphate
6. 456 55.6% 108 122 596.4 3e-26 1uzh:C A chimeric chlamydomonas, synechococcus rubisco enzyme
7. 299 41.0% 105 108 395.8 4.5e-15 1svd:M The structure of halothiobacillus neapolitanus rubisco
8. 291 43.3% 97 138 383.9 2e-14 1bwv:S Activated ribulose 1,5-bisphosphate carboxylase/oxygenase (r complexed with the reaction intermediate analogue 2-carboxy 1,5-bisphosphate
9. 291 43.3% 97 138 383.9 2e-14 1iwa:B Rubisco from galdieria partita
10. 365 43.4% 122 122 368.0 1.6e-13 1ir1:S Crystal structure of spinach ribulose-1,5-bisphosphate carboxylase/oxygenase (rubisco) complexed with co2, mg2+ an carboxyarabinitol-1,5-bisphosphate
11. 353 43.0% 114 123 366.7 1.9e-13 1bur:S Ribulose 1,5-bisphosphate carboxylase/oxygenase complexed with carbon dioxide, mg==2+== and 2-carboxyarabinitol-1,5-bisphosphate
12. 277 42.3% 97 138 366.0 2e-13 4f0h:B * Unactivated rubisco with oxygen bound
13. " " " " " "  = 4f0k:B *
Unactivated rubisco with magnesium and carbon dioxide bound
14. " " " " " "  = 4f0m:B *
Unactivated rubisco with magnesium and a water molecule boun
15. 354 42.1% 114 123 360.3 4.2e-13 1aa1:S * Activated spinach rubisco in complex with the product 3- phosphoglycerate
16. " " " " " "  = 1aus:S *
Activated unliganded spinach rubisco
17. " " " " " "  = 1rbo:S *
Spinach rubisco in complex with the inhibitor 2-carboxyarabi diphosphate
18. " " " " " "  = 1rco:S *
Spinach rubisco in complex with the inhibitor d-xylulose-2, 2-diol-1,5-bisphosphate
19. " " " " " "  = 1rcx:S *
Non-activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate
20. " " " " " "  = 1rxo:S *
Activated spinach rubisco in complex with its substrate ribu bisphosphate and calcium
21. " " " " " "  = 1upm:C *
Activated spinach rubisco complexed with 2-carboxyarabinitol 2 bisphosphat and ca2+.
22. " " " " " "  = 1upp:I *
Spinach rubisco in complex with 2-carboxyarabinitol 2 bisphosphate and calcium.
23. " " " " " "  = 8ruc:I *
Activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate
24. 268 40.2% 97 129 354.9 8.5e-13 1bxn:I The crystal structure of rubisco from alcaligenes eutrophus angstroms.
25. 352 43.0% 114 123 347.5 2.2e-12 8rub:S Lyase(carbon-carbon)
26. 376 45.0% 120 129 340.8 5.2e-12 1uzd:C Chlamydomonas,spinach chimeric rubisco
27. 339 41.5% 123 123 334.6 1.1e-11 4hhh:S Structure of pisum sativum rubisco
28. 333 40.7% 123 123 330.8 1.9e-11 1ej7:S * Crystal structure of unactivated tobacco rubisco with bound ions
29. " " " " " "  = 1rlc:S *
Crystal structure of the unactivated ribulose 1, 5-bisphosph carboxylase(slash)oxygenase complexed with a transition sta 2-carboxy-d-arabinitol 1,5-bisphosphate
30. " " " " " "  = 1rld:S *
Solid-state phase transition in the crystal structure of rib biphosphate carboxylase(slash)oxygenase
31. " " " " " "  = 3rub:S *
Crystal structure of the unactivated form of ribulose-1,5-bi carboxylase(slash)oxygenase from tobacco refined at 2.0-ang resolution
32. 330 40.7% 123 123 326.9 3e-11 4rub:S A crystal form of ribulose-1,5-bisphosphate carboxylase(slas oxygenase from nicotiana tabacum in the activated state
33. 334 41.8% 110 121 321.9 5.8e-11 1wdd:S Crystal structure of activated rice rubisco complexed with 2 carboxyarabinitol-1,5-bisphosphate
34. 340 41.2% 119 120 321.9 5.8e-11 3axk:S Structure of rice rubisco in complex with NADP(h)

Number of sequences: 34

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 340 41.2% 119 122 321.8 5.9e-11 3axm:S Structure of rice rubisco in complex with 6pg
2. 328 39.8% 123 123 320.5 6.9e-11 4mkv:S Structure of pisum sativum rubisco with aba
3. 355 45.3% 117 125 319.1 8.3e-11 1gk8:I Rubisco from chlamydomonas reinhardtii
4. 359 46.2% 117 139 318.4 9.1e-11 1ir2:I Crystal structure of activated ribulose-1,5-bisphosphate carboxylase/oxygenase (rubisco) from green alga, chlamydomo reinhardtii complexed with 2-carboxyarabinitol-1,5-bisphosp cabp)
5. 356 43.7% 126 140 318.4 9.1e-11 1uw9:C * L290f-a222t chlamydomonas rubisco mutant
6. " " " " " "  = 1uwa:C *
L290f mutant rubisco from chlamydomonas
7. 355 45.3% 117 139 318.4 9.1e-11 2v63:I * Crystal structure of rubisco from chlamydomonas reinhardtii with a large-subunit v331a mutation
8. " " " " " "  = 2v67:I *
Crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit supressor mutation t342i
9. " " " " " "  = 2v68:I *
Crystal structure of chlamydomonas reinhardtii rubisco with large-subunit mutations v331a, t342i
10. " " " " " "  = 2v69:I *
Crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit mutation d473e
11. " " " " " "  = 2v6a:I *
Crystal structure of chlamydomonas reinhardtii rubisco with large-subunit mutations v331a, g344s
12. " " " " " "  = 2vdh:I *
Crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit c172s mutation
13. " " " " " "  = 2vdi:I *
Crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit c192s mutation
14. 90 28.4% 67 216 123.2 6.8 4bsv:A Heterodimeric fc antibody azymetric variant 1
15. 89 28.4% 67 216 121.9 8 4bsw:A Heterodimeric fc antibody azymetric variant 2
16. 88 20.6% 102 441 116.1 17 3biq:A Crystal structure of yeast spt16 n-terminal domain
17. 88 20.6% 102 444 116.0 17 3bip:A Crystal structure of yeast spt16 n-terminal domain
18. 88 20.6% 102 447 116.0 17 3bit:A Crystal structure of yeast spt16 n-terminal domain
19. 78 25.6% 39 75 114.6 21 2ofs:A Crystal structure of human cd59
20. 76 44.4% 27 52 114.4 21 1bdt:A * Wild type gene-regulating protein arc/DNA complex
21. " " " " " "  = 1par:A *
DNA recognition by beta-sheets in the arc repressor- operator crystal structure
22. 76 44.4% 27 53 114.2 21 1arq:A * Relaxation matrix refinement of the solution structure of the arc repressor
23. " " " " " "  = 1arr:A *
Relaxation matrix refinement of the solution structure of the arc repressor
24. 76 44.4% 27 53 114.2 21 1b28:A Arc repressor myl mutant from salmonella bacteriophage p22
25. 80 35.7% 42 122 114.0 22 3pmi:A Pwwp domain of human mutated melanoma-associated antigen 1
26. 85 25.8% 93 340 113.9 22 2dep:A Crystal structure of xylanase b from clostridium stercorarium f9
27. 76 25.6% 39 70 112.4 27 1erg:A * Three-dimensional solution structure of the extracellular region of the complement regulatory protein, cd59, a new cell surface protein domain related to neurotoxins
28. " " " " " "  = 1erh:A *
Three-dimensional solution structure of the extracellular region of the complement regulatory protein, cd59, a new cell surface protein domain related to neurotoxins
29. 76 25.6% 39 77 111.8 29 1cdq:A * Structure of a soluble, glycosylated form of the human complement regulatory protein cd59
30. " " " " " "  = 1cdr:A *
Structure of a soluble, glycosylated form of the human compl regulatory protein cd59
31. " " " " " "  = 1cds:A *
Structure of a soluble, glycosylated form of the human compl regulatory protein cd59
32. 76 25.6% 39 78 111.8 29 2j8b:A * High resolution structure of human cd59
33. " " " " " "  = 2ux2:A *
High resolution structure of human cd59
34. 76 25.6% 39 77 111.8 29 4bik:B Structure of a disulfide locked mutant of intermedilysin with human cd59
35. 76 25.6% 39 79 111.7 30 2uwr:A High resolution structure of human cd59
36. 73 44.0% 25 45 111.4 31 1myl:A Substituting hydrophobic residues for a buried salt bridge enhances protein stability but does not reduce conformational specificity
37. 77 22.5% 71 114 110.6 34 2red:A Crystal structures of c2alpha-pi3 kinase px-domain domain in conformational change associated with ligand binding.
38. 78 27.7% 47 159 109.8 38 1wy6:A Crystal structure of hypothetical protein [st1625p] from hyperthermophilic archaeon sulfolobus tokodaii
39. 78 27.7% 47 161 109.7 38 1vdu:A Crystal structure of hypothetical protein [st1625] from hyperthermophilic archaeon sulfolobus tokodaii
40. 81 26.2% 80 321 109.1 41 1tl9:A High resolution crystal structure of calpain i protease core complex with leupeptin
41. 81 26.2% 80 322 109.1 41 1tlo:A * High resolution crystal structure of calpain i protease core in complex with e64
42. " " " " " "  = 2g8j:A *
Calpain 1 proteolytic core in complex with snj-1945, a alpha-ketoamide-type inhibitor.
43. " " " " " "  = 2nqg:A *
Calpain 1 proteolytic core inactivated by wr18(s,s), an epoxysuccinyl-type inhibitor.
44. " " " " " "  = 2nqi:A *
Calpain 1 proteolytic core inactivated by wr13(r,r), an epoxysuccinyl-type inhibitor.
45. " " " " " "  = 2r9c:A *
Calpain 1 proteolytic core inactivated by zlak-3001, an alph ketoamide
46. " " " " " "  = 2r9f:A *
Calpain 1 proteolytic core inactivated by zlak-3002, an alph ketoamide
47. 81 26.2% 80 326 109.0 42 2g8e:A Calpain 1 proteolytic core in complex with snj-1715, a cycli hemiacetal-type inhibitor
48. 80 25.6% 90 300 108.3 46 2dsk:A Crystal structure of catalytic domain of hyperthermophilic c from pyrococcus furiosus
49. 80 25.6% 90 300 108.3 46 3a4x:A * Crystal structures of catalytic site mutants of active domai thermostable chitinase from pyrococcus furiosus complexed w oligosaccharides
50. " " " " " "  = 3afb:A *
Crystal structures of catalytic site mutants of active domai chitinase from pyrococcus furiosus
51. 80 25.6% 90 301 108.2 46 3a4w:A Crystal structures of catalytic site mutants of active domai thermostable chitinase from pyrococcus furiosus complexed w oligosaccharides

Number of sequences: 51

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer