spacer
spacer

SAS results for UniProt accession no. P62942

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand   to metal
Catalytic residues:   (from CSA)
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P62942 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P62942 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 121 unique sequences (including 22 consensus sequences) giving 190 sequence matches in all. The 135 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P62942 ---------------------mgvqve--tispgdgrtfpkrgqtcvvhytgmledgkkfdssrd    Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens  ...
3mdy:B --------------------smgvqve--tispgdgrtfpkrgqtcvvhytgmledgkkfdssrd    Crystal structure of the cytoplasmic domain of the bone  ...
1a7x:A*----------------------GVQVE--TISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRD×33 Fkbp12-fk1012 complex
2ppp:A ----------------------gvqve--tispgdgrtfpkrgqtcvvhytgmledgkkfdssrd    Crystal structure of e60q mutant of fkbp12
2ppo:A ----------------------gvqve--tispgdgrtfpkrgqtcvvhytgmledgkkfdssrd    Crystal structure of e60a mutant of fkbp12
1eym:A ----------------------gvqve--tispgdgrtfpkrgqtcvvhytgmledgkkmdssrd    Fk506 binding protein mutant, homodimeric complex
1bl4:A ----------------------GVQVE--TISPGDGRTFPKRGQTCVVHYTGMLEDGKKVDSSRD    Fkbp mutant f36v complexed with remodeled synthetic ligand
1tco:C ----------------------GVQVE--TISPGDGRTFPKAGQTCVVHYTGMLEDGKKFDSSRD    Ternary complex of a calcineurin a fragment, calcineurin b,  ...
2dg4:A ----------------------GVQVE--TISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRD    Fk506-binding protein mutant wf59 complexed with rapamycin
1fkk:A*----------------------GVQVE--TISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRD×2  Atomic structure of fkbp12, an immunophilin binding protein
2dg9:A ----------------------GVQVE--TISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRD    Fk506-binding protein mutant wl59 complexed with rapamycin
1bkf:A ----------------------GVQVE--TISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRD    Fk506 binding protein fkbp mutant r42k/h87v complex with  ...
4n19:A ----------------------GVQVE--TISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRD    Structural basis of conformational transitions in the  ...
4ipx:A ----------------------GVQVE--TISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRD    Analyzing the visible conformational substates of the fk506  ...
4c02:B ---------------------MGVEIE--TISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRD    Crystal structure of human acvr1 (alk2) in complex with  ...
1c9h:A ----------------------GVEIE--TISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRD    Crystal structure of fkbp12.6 in complex with rapamycin
4iq2:A*----------------------GVEIE--TISPGDGRTFPKKGQTVVVHYTGMLQNGKKFDSSRD×2  P21 crystal form of fkbp12.6
2lpv:A*---------------------MGVQVV--TLAAGDEATYPKAGQVAVVHYTGTLADGKVFDSSRT×2  Solution structure of fkbp12 from aedes aegypti
1yat:A ----------------SEVIEGNVKID--RISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVD    Improved calcineurin inhibition by yeast fkbp12-drug  ...
2lgo:A mahhhhhhmgtleaqtqgpgsmsaqlekkvltpgdgvtkpqagkkvtvhydgrfpdgkqfdssrs    Solution nmr structure of a fkbp-type peptidyl-prolyl  ...
4dz3:A --------------STVVTTESGLKYE--DLTEGSG-AEARAGQTVSVHYTGWLTDGQKFDSSKD    Crystal structure of a peptidyl-prolyl cis-trans isomerase  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P62942 rnkpfkfmlgkqevirgweegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkl    Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens  ...
3mdy:B rnkpfkfmlgkqevirgweegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkl    Crystal structure of the cytoplasmic domain of the bone  ...
1a7x:A*RNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKL×33 Fkbp12-fk1012 complex
2ppp:A rnkpfkfmlgkqevirgwqegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkl    Crystal structure of e60q mutant of fkbp12
2ppo:A rnkpfkfmlgkqevirgwaegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkl    Crystal structure of e60a mutant of fkbp12
1eym:A rnkpfkfmlgkqevirgweegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkl    Fk506 binding protein mutant, homodimeric complex
1bl4:A RNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKL    Fkbp mutant f36v complexed with remodeled synthetic ligand
1tco:C RNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKL    Ternary complex of a calcineurin a fragment, calcineurin b,  ...
2dg4:A RNKPFKFMLGKQEVIRGFEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKL    Fk506-binding protein mutant wf59 complexed with rapamycin
1fkk:A*RNKPFKFVLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKL×2  Atomic structure of fkbp12, an immunophilin binding protein
2dg9:A RNKPFKFMLGKQEVIRGLEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKL    Fk506-binding protein mutant wl59 complexed with rapamycin
1bkf:A KNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKL    Fk506 binding protein fkbp mutant r42k/h87v complex with  ...
4n19:A RNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPPIIPPHATLVFDVELLKL    Structural basis of conformational transitions in the  ...
4ipx:A RNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKL    Analyzing the visible conformational substates of the fk506  ...
4c02:B RNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNL    Crystal structure of human acvr1 (alk2) in complex with  ...
1c9h:A RNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNL    Crystal structure of fkbp12.6 in complex with rapamycin
4iq2:A*RNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTITPDVAYGATGHPGVIPPNATLIFDVELLNL×2  P21 crystal form of fkbp12.6
2lpv:A*RGKPFRFTVGRGEVIRGWDEGVAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNATLTFDVELLRV×2  Solution structure of fkbp12 from aedes aegypti
1yat:A RGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKV    Improved calcineurin inhibition by yeast fkbp12-drug  ...
2lgo:A rgkpfqftlgagevikgwdqgvatmtlgekalftipyqlaygergyppvippkatlvfevellav    Solution nmr structure of a fkbp-type peptidyl-prolyl  ...
4dz3:A RNDPFAFVLGGGHVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV    Crystal structure of a peptidyl-prolyl cis-trans isomerase  ...

        
        
       1                                                                    Protein name
       -                                                                    ------------
P62942 e                                                                    Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens  ...
3mdy:B e                                                                    Crystal structure of the cytoplasmic domain of the bone  ...
1a7x:A*E                                                                ×33 Fkbp12-fk1012 complex
2ppp:A e                                                                    Crystal structure of e60q mutant of fkbp12
2ppo:A e                                                                    Crystal structure of e60a mutant of fkbp12
1eym:A e                                                                    Fk506 binding protein mutant, homodimeric complex
1bl4:A E                                                                    Fkbp mutant f36v complexed with remodeled synthetic ligand
1tco:C E                                                                    Ternary complex of a calcineurin a fragment, calcineurin b,  ...
2dg4:A E                                                                    Fk506-binding protein mutant wf59 complexed with rapamycin
1fkk:A*E                                                                ×2  Atomic structure of fkbp12, an immunophilin binding protein
2dg9:A E                                                                    Fk506-binding protein mutant wl59 complexed with rapamycin
1bkf:A E                                                                    Fk506 binding protein fkbp mutant r42k/h87v complex with  ...
4n19:A E                                                                    Structural basis of conformational transitions in the  ...
4ipx:A E                                                                    Analyzing the visible conformational substates of the fk506  ...
4c02:B E                                                                    Crystal structure of human acvr1 (alk2) in complex with  ...
1c9h:A E                                                                    Crystal structure of fkbp12.6 in complex with rapamycin
4iq2:A*E                                                                ×2  P21 crystal form of fkbp12.6
2lpv:A*E                                                                ×2  Solution structure of fkbp12 from aedes aegypti
1yat:A N                                                                    Improved calcineurin inhibition by yeast fkbp12-drug  ...
2lgo:A -                                                                    Solution nmr structure of a fkbp-type peptidyl-prolyl  ...
4dz3:A -                                                                    Crystal structure of a peptidyl-prolyl cis-trans isomerase  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P62942. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 108 - - P62942 Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens GN=FKBP1A PE=1 SV=2
2. 736 100.0% 108 109 1019.2 8.5e-50 3mdy:B Crystal structure of the cytoplasmic domain of the bone morp protein receptor type-1b (bmpr1b) in complex with fkbp12 an 193189
3. 729 100.0% 107 107 1009.8 2.9e-49 1a7x:A * Fkbp12-fk1012 complex
4. " " " " " "  = 1b6c:A *
Crystal structure of the cytoplasmic domain of the type i tgf-beta receptor in complex with fkbp12
5. " " " " " "  = 1d6o:A *
Native fkbp
6. " " " " " "  = 1d7h:A *
Fkbp complexed with dmso
7. " " " " " "  = 1d7i:A *
Fkbp complexed with methyl methylsulfinylmethyl sulfide (dss
8. " " " " " "  = 1d7j:A *
Fkbp complexed with 4-hydroxy-2-butanone
9. " " " " " "  = 1f40:A *
Solution structure of fkbp12 complexed with gpi-1046, a neurotrophic ligand
10. " " " " " "  = 1fap:A *
The structure of the immunophilin-immunosuppressant fkbp12- rapamycin complex interacting with human frap
11. " " " " " "  = 1fkb:A *
Atomic structure of the rapamycin human immunophilin fkbp- 12 complex
12. " " " " " "  = 1fkd:A *
Fk-506 binding protein: three-dimensional structure of thE C with the antagonist l-685,818
13. " " " " " "  = 1fkf:A *
Atomic structure of fkbp-fk506, an immunophilin-immunosuppre complex
14. " " " " " "  = 1fkg:A *
Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
15. " " " " " "  = 1fkh:A *
Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
16. " " " " " "  = 1fki:A *
Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
17. " " " " " "  = 1fkj:A *
Atomic structure of fkbp12-fk506, an immunophilin immunosupp complex
18. " " " " " "  = 1fkr:A *
Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
19. " " " " " "  = 1fks:A *
Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
20. " " " " " "  = 1fkt:A *
Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
21. " " " " " "  = 1j4h:A *
Crystal structure analysis of the fkbp12 complexed with 000107 small molecule
22. " " " " " "  = 1j4i:A *
Crystal structure analysis of the fkbp12 complexed with 000308 small molecule
23. " " " " " "  = 1j4r:A *
Fk506 binding protein complexed with fkb-001
24. " " " " " "  = 1nsg:A *
The structure of the immunophilin-immunosuppressant fkbp12-r complex interacting with human frap
25. " " " " " "  = 1qpf:A *
Fk506 binding protein (12 kda, human) complex with l-709,858
26. " " " " " "  = 1qpl:A *
Fk506 binding protein (12 kda, human) complex with l-707,587
27. " " " " " "  = 2dg3:A *
Wildtype fk506-binding protein complexed with rapamycin
28. " " " " " "  = 2fap:A *
The structure of the immunophilin-immunosuppressant fkbp12-( ethoxy rapamycin complex interacting with huma
29. " " " " " "  = 2fke:A *
Fk-506-binding protein: three-dimensional structure of thE C with the antagonist l-685,818
30. " " " " " "  = 2ppn:A *
Crystal structure of fkbp12
31. " " " " " "  = 2rse:A *
Nmr structure of fkbp12-mtor frb domain-rapamycin complex st determined based on pcs
32. " " " " " "  = 3fap:A *
Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
33. " " " " " "  = 3h9r:B *
Crystal structure of the kinase domain of type i activin rec (acvr1) in complex with fkbp12 and dorsomorphin
34. " " " " " "  = 4dh0:A *
X-ray crystal structure of 28-o-methylrapamycin complexed wi is the cyclohexyl moiety part of the effector domain of rap
35. " " " " " "  = 4fap:A *
Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
36. 725 99.1% 107 107 1004.3 5.8e-49 2ppp:A Crystal structure of e60q mutant of fkbp12
37. 722 99.1% 107 107 1000.2 9.8e-49 2ppo:A Crystal structure of e60a mutant of fkbp12
38. 721 99.1% 107 107 998.8 1.2e-48 1eym:A Fk506 binding protein mutant, homodimeric complex
39. 720 99.1% 107 107 997.4 1.4e-48 1bl4:A Fkbp mutant f36v complexed with remodeled synthetic ligand
40. 720 99.1% 107 107 997.4 1.4e-48 1tco:C Ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)
41. 715 99.1% 107 107 990.6 3.4e-48 2dg4:A Fk506-binding protein mutant wf59 complexed with rapamycin
42. 713 97.2% 107 107 987.8 4.8e-48 1fkk:A * Atomic structure of fkbp12, an immunophilin binding protein
43. " " " " " "  = 1fkl:A *
Atomic structure of fkbp12-rapaymycin, an immunophilin- immunosuppressant complex
44. 712 99.1% 107 107 986.4 5.7e-48 2dg9:A Fk506-binding protein mutant wl59 complexed with rapamycin
45. 711 98.1% 107 107 985.1 6.8e-48 1bkf:A Fk506 binding protein fkbp mutant r42k/h87v complex with immunosuppressant fk506
46. 705 98.1% 107 107 976.8 2e-47 4n19:A Structural basis of conformational transitions in the active 80 s loop in the fk506 binding protein fkbp12
47. 701 98.1% 107 107 971.4 4e-47 4ipx:A Analyzing the visible conformational substates of the fk506 protein fkbp12
48. 641 83.3% 108 108 889.0 1.5e-42 4c02:B Crystal structure of human acvr1 (alk2) in complex with fkbp12.6 and dorsomorphin
49. 634 83.2% 107 107 879.4 5.2e-42 1c9h:A Crystal structure of fkbp12.6 in complex with rapamycin
50. 627 83.2% 107 107 869.8 1.8e-41 4iq2:A * P21 crystal form of fkbp12.6
51. " " " " " "  = 4iqc:A *
P3121 crystal form of fkbp12.6
52. 542 72.2% 108 108 753.2 5.6e-35 2lpv:A * Solution structure of fkbp12 from aedes aegypti
53. " " " " " "  = 3uqi:A *
Crystallographic structure of fkbp12 from aedes aegypti
54. 445 58.1% 105 113 619.8 1.5e-27 1yat:A Improved calcineurin inhibition by yeast fkbp12-drug complexes. Crystallographic and functional analysis
55. 407 55.1% 107 130 566.7 1.4e-24 2lgo:A Solution nmr structure of a fkbp-type peptidyl-prolyl cis-tr isomerase from giardia lamblia, seattle structural genomics for infectious disease target gilaa.00840.A
56. 390 56.7% 104 113 544.3 2.4e-23 4dz3:A Crystal structure of a peptidyl-prolyl cis-trans isomerase w surface mutation m61h from burkholderia pseudomallei comple fk506

Number of sequences: 56

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 388 56.7% 104 117 541.3 3.5e-23 2ke0:A * Solution structure of peptidyl-prolyl cis-trans isomerase fr burkholderia pseudomallei
2. " " " " " "  = 2ko7:A *
Solution structure of peptidyl-prolyl cis-trans isomerase fr burkholderia pseudomallei complexed with cycloheximide-n- ethylethanoate
3. " " " " " "  = 2l2s:A *
Solution structure of peptidyl-prolyl cis-trans isomerase fr burkholderia pseudomallei complexed with 1-{[(4-methylpheny thio]acetyl}piperidine
4. 388 56.7% 104 122 541.0 3.7e-23 2y78:A Crystal structure of bpss1823, a mip-like chaperone from burkholderia pseudomallei
5. 390 56.7% 104 190 540.7 3.9e-23 3uqa:A Crystal structure of a smt fusion peptidyl-prolyl cis-trans with surface mutation a54e from burkholderia pseudomallei c with fk506
6. 387 56.7% 104 113 540.2 4.1e-23 4dz2:A Crystal structure of a peptidyl-prolyl cis-trans isomerase w surface mutation r92g from burkholderia pseudomallei comple fk506
7. 389 56.7% 104 192 539.2 4.7e-23 3uf8:A Crystal structure of a smt fusion peptidyl-prolyl cis-trans with a g95a surface mutation from burkholderia pseudomallei with fk506
8. 388 56.7% 104 177 538.4 5.2e-23 4ggq:D Crystal structure of a smt fusion peptidyl-prolyl cis-trans from burkholderia pseudomallei complexed with cj40
9. 388 56.7% 104 185 538.1 5.4e-23 3vaw:A Crystal structure of a smt fusion peptidyl-prolyl cis-trans with surface mutation v3i from burkholderia pseudomallei co with fk506
10. 388 56.7% 104 191 537.9 5.5e-23 4ggq:C Crystal structure of a smt fusion peptidyl-prolyl cis-trans from burkholderia pseudomallei complexed with cj40
11. 379 55.8% 104 190 525.6 2.7e-22 4fn2:A Crystal structure of a smt fusion peptidyl-prolyl cis-trans with surface mutation d44g from burkholderia pseudomallei c with cj37
12. 379 55.8% 104 191 525.5 2.7e-22 4g50:A Crystal structure of a smt fusion peptidyl-prolyl cis-trans with surface mutation d44g from burkholderia pseudomallei c with cj168
13. 379 55.8% 104 192 525.5 2.7e-22 4giv:A Crystal structure of a smt fusion peptidyl-prolyl cis-trans with surface mutation d44g from burkholderia pseudomallei c with cj183
14. 368 55.8% 104 191 510.4 1.9e-21 3uqb:A Crystal structure of a smt fusion peptidyl-prolyl cis-trans with surface mutation d44g from burkholderia pseudomallei c with fk506
15. 340 53.1% 98 118 475.4 1.7e-19 1rot:A * Structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, minimized average structure
16. " " " " " "  = 1rou:A *
Structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, 22 structures
17. 338 52.0% 98 121 472.5 2.4e-19 4drj:A O-crystal structure of the ppiase domain of fkbp52, rapamyci frb fragment of mtor
18. 335 53.1% 96 118 468.6 4e-19 1r9h:A Structural genomics of c.Elegans: fkbp-type peptidylprolyl isomerase
19. 338 52.0% 98 237 467.8 4.4e-19 1q1c:A Crystal structure of n(1-260) of human fkbp52
20. 338 52.0% 98 235 467.8 4.4e-19 4law:A Crystal structure analysis of fkbp52, crystal form iii
21. 338 52.0% 98 237 467.8 4.4e-19 4lax:A Crystal structure analysis of fkbp52, complex with fk506
22. 338 52.0% 98 234 467.8 4.4e-19 4lay:A Crystal structure analysis of fkbp52, complex with i63
23. 338 52.0% 98 240 467.7 4.5e-19 4lav:A Crystal structure analysis of fkbp52, crystal form ii
24. 321 50.0% 98 121 449.2 4.8e-18 4dri:A Co-crystal structure of the ppiase domain of fkbp51, rapamyc frb fragment of mtor
25. 321 50.0% 98 125 449.0 5e-18 3o5f:A Fk1 domain of fkbp51, crystal form vii
26. 321 50.0% 98 124 449.0 4.9e-18 3o5j:A Fk1 domain of fkbp51, crystal form iii
27. 321 50.0% 98 128 448.8 5.1e-18 3o5e:A Fk1 domain of fkbp51, crystal form vi
28. 321 50.0% 98 128 448.8 5.1e-18 3o5g:A * Fk1 domain of fkbp51, crystal form i
29. " " " " " "  = 3o5i:A *
Fk1 domain of fkbp51, crystal form ii
30. 321 50.0% 98 127 448.8 5e-18 3o5k:A Fk1 domain of fkbp51, crystal form viii
31. 321 50.0% 98 128 448.8 5.1e-18 3o5l:A Fk1 domain mutant a19t of fkbp51, crystal form i
32. 321 50.0% 98 127 448.8 5e-18 3o5m:A Fk1 domain mutant a19t of fkbp51, crystal form ii
33. 321 50.0% 98 128 448.8 5.1e-18 3o5o:A * Fk1 domain mutant a19t of fkbp51, crystal form iii
34. " " " " " "  = 3o5p:A *
Fk1 domain mutant a19t of fkbp51, crystal form iv
35. " " " " " "  = 3o5q:A *
Fk1 domain mutant a19t of fkbp51, crystal form iv, in presen
36. " " " " " "  = 3o5r:A *
Complex of fk506 with the fk1 domain mutant a19t of fkbp51
37. " " " " " "  = 4drk:A *
Evaluation of synthetic fk506 analogs as ligands for fkbp51 fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphe ({[(2s)-1-(3,3-dimethyl-2-oxopentanoyl)piperidin-2-yl]carbo propyl]phenoxy}acetic acid
38. " " " " " "  = 4drm:A *
Evaluation of synthetic fk506 analogs as ligands for fkbp51 fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphe ({[(2s)-1-{[(1s,2r)-2-ethyl-1-hydroxycyclohexyl](oxo) acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic ac
39. " " " " " "  = 4drn:A *
Evaluation of synthetic fk506 analogs as ligands for fkbp51 fkbp52: complex of fkbp51 with {3-[(1r)-3-(3,4-dimethoxyphe ({[(2s)-1-{[(1s,2r)-2-ethyl-1-hydroxycyclohexyl](oxo) acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic ac
40. " " " " " "  = 4dro:A *
Evaluation of synthetic fk506 analogs as ligands for fkbp51 fkbp52: complex of fkbp51 with (1r)-3-(3,4-dimethoxyphenyl) phenylpropyl (2s)-1-{[(1r,2s)-2-ethyl-1-hydroxycyclohexyl]( acetyl}piperidine-2-carboxylate
41. " " " " " "  = 4drp:A *
Evaluation of synthetic fk506 analogs as ligands for the fk5 proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-3-(3,4 dimethoxyphenyl)-1-((s)-1-(2-((1r,2s)-2-ethyl-1-hydroxy-cyc 2-oxoacetyl)piperidine-2-carbonyloxy)propyl)phenoxy)acetic cocrystallization
42. " " " " " "  = 4drq:A *
Exploration of pipecolate sulfonamides as binders of the fk5 proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-1-((s) dichlorophenylsulfonyl)piperidine-2-carbonyloxy)-3-(3,4-dim phenyl)propyl)phenoxy)acetic acid
43. 321 50.0% 98 127 448.8 5e-18 4jfi:A Increasing the efficiency efficiency of ligands for the fk50 protein 51 by conformational control: complex of fkbp51 wit 1-[(9s,13r,13ar)-1,3-dimethoxy-8-oxo-5,8,9,10,11,12,13,13a- 6h-9,13-epiminoazocino[2,1-a]isoquinolin-14-yl]-2-(3,4,5- trimethoxyphenyl)ethane-1,2-dione
44. 321 50.0% 98 128 448.8 5.1e-18 4jfj:A * Increasing the efficiency efficiency of ligands for the fk50 protein 51 by conformational control: complex of fkbp51 wit (1s,6r)-10-(1,3-benzothiazol-6-ylsulfonyl)-3-[2-(3,4- dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
45. " " " " " "  = 4jfk:A *
Increasing the efficiency efficiency of ligands for the fk50 protein 51 by conformational control: complex of fkbp51 wit 3-[2-(3,4-dimethoxyphenoxy)ethyl]-10-[(2-oxo-2,3-dihydro-1, benzothiazol-6-yl)sulfonyl]-3,10-diazabicyclo[4.3.1]decan-2
46. " " " " " "  = 4jfl:A *
Increasing the efficiency efficiency of ligands for the fk50 protein 51 by conformational control: complex of fkbp51 wit 5r)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-2-oxo-3,9- diazabicyclo[3.3.1]non-9-yl}sulfonyl)-1,3-benzothiazol-2(3h
47. " " " " " "  = 4jfm:A *
Increasing the efficiency efficiency of ligands for the fk50 protein 51 by conformational control: complex of fkbp51 wit dimethoxyphenoxy)ethyl (2s)-1-[(2-oxo-2,3-dihydro-1,3-benzo yl)sulfonyl]piperidine-2-carboxylate
48. 321 50.0% 98 132 448.6 5.2e-18 4drh:A Co-crystal structure of the ppiase domain of fkbp51, rapamyc frb fragment of mtor at low ph
49. 321 50.0% 98 242 444.3 9e-18 3o5d:A Crystal structure of a fragment of fkbp51 comprising the fk1 domains
50. 314 46.7% 107 160 437.6 2.1e-17 1jvw:A Trypanosoma cruzi macrophage infectivity potentiator (tcmip)
51. 306 50.0% 98 121 428.6 6.7e-17 1n1a:A Crystal structure of the n-terminal domain of human fkbp52
52. 305 50.5% 91 100 428.6 6.8e-17 2pbc:A Fk506-binding protein 2
53. 305 50.5% 91 102 428.5 6.9e-17 4nnr:A Fkbp13-fk506 complex
54. 298 46.7% 107 210 413.7 4.5e-16 1q6h:A * Crystal structure of a truncated form of fkpa from escherich
55. " " " " " "  = 1q6i:A *
Crystal structure of a truncated form of fkpa from escherich in complex with immunosuppressant fk506
56. 298 46.7% 107 213 413.6 4.6e-16 1q6u:A Crystal structure of fkpa from escherichia coli
57. 292 44.1% 111 116 408.3 9.1e-16 1pbk:A Homologous domain of human fkbp25
58. 290 44.1% 111 119 405.4 1.3e-15 3kz7:A C-terminal domain of murine fkbp25 rapamycin complex
59. 288 42.2% 109 121 403.9 1.6e-15 4itz:A Crystal structure of the fk506 binding domain of plasmodium fkbp35 in complex with a tetrapeptide substrate
60. 288 42.2% 109 122 403.9 1.6e-15 4j4o:A * Crystal structure of fk506 binding domain of plasmodium viva in complex with d44
61. " " " " " "  = 4mgv:A *
Crystal structure of fk506 binding domain of plasmodium viva in complex with inhibitor d5
62. 288 42.2% 109 123 403.8 1.6e-15 3ihz:A Crystal structure of the fk506 binding domain of plasmodium fkbp35 in complex with fk506
63. 288 42.2% 109 124 403.7 1.6e-15 3ni6:A * Crystal structure of the fk506 binding domain of plasmodium fkbp35
64. " " " " " "  = 3pa7:A *
Crystal structure of fkbp from plasmodium vivax in complex w tetrapeptide alpf
65. 288 42.2% 109 126 403.6 1.7e-15 2ki3:A Structural and biochemical characterization of fk506 binding domain from plasmodium vivax
66. 264 41.1% 107 117 371.2 1.1e-13 4bf8:A Fpr4 ppi domain
67. 261 43.1% 109 123 366.8 1.9e-13 2vn1:A * Crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with fk506
68. " " " " " "  = 4j4n:A *
Crystal structure of fk506 binding domain of plasmodium falc fkbp35 in complex with d44
69. 261 43.1% 109 135 366.1 2e-13 2ofn:A Solution structure of fk506-binding domain (fkbd)of fkbp35 f plasmodium falciparum
70. 252 43.0% 93 121 354.5 9e-13 4dip:A Crystal structure of human peptidyl-prolyl cis-trans isomera
71. 252 43.0% 93 189 351.4 1.3e-12 4msp:A Crystal structure of human peptidyl-prolyl cis-trans isomera (aka fkbp14) containing two ef-hand motifs
72. 224 36.4% 99 236 311.4 2.3e-10 3jxv:A Crystal structure of the 3 fkbp domains of wheat fkbp73
73. 224 36.4% 99 300 309.7 2.8e-10 3jym:A Crystal structure of the 3 fkbp domains of wheat fkbp73
74. 214 34.6% 107 137 301.5 8.1e-10 2uz5:A * Solution structure of the fkbp-domain of legionella pneumophila mip
75. " " " " " "  = 2vcd:A *
Solution structure of the fkbp-domain of legionella pneumophila mip in complex with rapamycin
76. 214 34.6% 107 204 298.7 1.2e-09 1fd9:A Crystal structure of the macrophage infectivity potentiator (mip) a major virulence factor from legionella pneumophila
77. 246 41.8% 98 125 296.7 1.5e-09 1u79:A * Crystal structure of atfkbp13
78. " " " " " "  = 1y0o:A *
Crystal structure of reduced atfkbp13
79. 210 37.5% 104 133 296.2 1.6e-09 3oe2:A 1.6 a crystal structure of peptidyl-prolyl cis-trans isomera from pseudomonas syringae pv. Tomato str. Dc3000 (pspto dc3
80. 215 43.5% 92 357 281.0 1.1e-08 1kt0:A Structure of the large fkbp-like protein, fkbp51, involved i receptor complexes
81. 190 36.6% 101 118 269.7 4.8e-08 2awg:A Structure of the ppiase domain of the human fk506-binding protein 8
82. 190 36.6% 101 118 269.7 4.8e-08 3ey6:A Crystal structure of the fk506-binding domain of human fkbp3
83. 190 36.6% 101 121 269.5 4.9e-08 2f2d:A Solution structure of the fk506-binding domain of human fkbp38
84. 187 30.6% 111 131 264.8 9e-08 2f4e:A N-terminal domain of fkbp42 from arabidopsis thaliana
85. 184 36.8% 106 117 261.5 1.4e-07 3b7x:A Crystal structure of human fk506-binding protein 6
86. 187 30.6% 111 258 260.0 1.7e-07 2if4:A Crystal structure of a multi-domain immunophilin from arabidopsis thaliana
87. 178 36.3% 102 135 252.2 4.5e-07 2d9f:A Solution structure of ruh-047, an fkbp domain from human cdna
88. 178 36.3% 102 157 251.2 5.1e-07 2jwx:A * Solution structure of the n-terminal domain of human fkbp38 (fkbp38ntd)
89. " " " " " "  = 2mf9:A *
Solution structure of the n-terminal domain of human fkbp38 (fkbp38ntd)
90. 178 39.6% 96 374 236.8 3.3e-06 1kt1:A Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
91. 145 33.3% 69 160 205.8 0.00017 4dt4:A Crystal structure of the ppiase-chaperone slpa with the chap binding site occupied by the linker of the purification tag
92. 144 27.0% 111 283 200.4 0.00035 1p5q:A Crystal structure of fkbp52 c-terminal domain
93. 144 27.0% 111 285 200.3 0.00035 1qz2:A Crystal structure of fkbp52 c-terminal domain complex with thE C-terminal peptide meevd of hsp90
94. 124 32.1% 78 165 176.7 0.0072 2lkn:A Solution structure of the ppiase domain of human aryl-hydroc receptor-interacting protein (aip)
95. 113 28.8% 66 151 162.3 0.046 2kr7:A Solution structure of helicobacter pylori slyd
96. 127 34.2% 79 151 154.0 0.13 1ix5:A Solution structure of the methanococcus thermolithotrophicus fkbp
97. 86 32.7% 55 119 126.9 4.3 3iz6:K * Localization of the small subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
98. " " " " " "  = 3j60:O *
Localization of the small subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
99. 83 30.9% 55 125 122.5 7.6 2zkq:k Structure of a mammalian ribosomal 40s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
100. 83 34.1% 41 126 122.4 7.7 3zey:H High-resolution cryo-electron microscopy structure of the tr brucei ribosome
101. 83 30.9% 55 136 121.9 8.2 3j3a:O * Structure of the human 40s ribosomal proteins
102. " " " " " "  = 4kzx:O *
Rabbit 40s ribosomal subunit in complex with eif1.
103. " " " " " "  = 4kzy:O *
Rabbit 40s ribosomal subunit in complex with eif1 and eif1a.
104. " " " " " "  = 4kzz:O *
Rabbit 40s ribosomal subunit in complex with mRNA, initiator eif1a
105. " " " " " "  = 4w23:O *
Structure of the 80s mammalian ribosome bound to eef2 (this contains the small ribosomal subunit)
106. " " " " " "  = 4w28:O *
Structure of the translating mammalian ribosome-sec61 comple entry contains the small ribosomal subunit)
107. 82 32.7% 55 127 121.0 9.2 3j7a:P Cryo-em structure of the plasmodium falciparum 80s ribosome the anti-protozoan drug emetine, small subunit
108. 86 33.3% 60 450 117.5 14 3njt:A Crystal structure of the r450a mutant of the membrane protei
109. 82 25.9% 54 226 116.9 16 2afj:A Spry domain-containing socs box protein 2 (ssb-2)
110. 86 33.3% 60 516 116.5 16 2qdz:A Structure of the membrane protein fhac: a member of the omp85/tpsb transporter family
111. 78 30.9% 55 119 116.0 18 3izb:K Localization of the small subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
112. 78 30.9% 55 125 115.6 18 1k5x:K * Structure of the translating 80s ribosome from yeast, obtained by docking atomic models for RNA and protein components into a 15a cryo-em map. This file 1k5x contains the 40s ribosomal subunit, the p-site bound tRNA and the mRNA codon. The file 1k5y contains the 60s ribosomal subunit.
113. " " " " " "  = 1s1h:K *
Structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 a cryo-em map. This file, 1s1h, contains 40s subunit. The 60s ribosomal subunit is in file 1s1i.
114. 78 30.9% 55 125 115.6 18 3jyv:K Structure of the 40s rrna and proteins and p/e tRNA for euka ribosome based on cryo-em map of thermomyces lanuginosus ri 8.9a resolution
115. 78 30.9% 55 127 115.5 19 3u5c:O * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 40s subunit, ribosome a
116. " " " " " "  = 4byl:O *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
117. " " " " " "  = 4byt:O *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
118. 78 30.9% 55 128 115.4 19 3o2z:H * Yeast 80s ribosome. This entry consists of the 40s subunit o first 80s in the asymmetric unit.
119. " " " " " "  = 3o30:H *
Yeast 80s ribosome. This entry consists of the 40s subunit o second 80s in the asymmetric unit.
120. 78 30.9% 55 128 115.4 19 3u5g:O The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 40s subunit, ribosome b
121. 85 27.3% 99 544 114.8 20 1nqf:A Outer membrane cobalamin transporter (btub) from e. Coli, me substiution construct for se-met sad phasing
122. 75 32.3% 65 86 114.1 22 1fu0:A * Crystal structure analysis of the phospho-serine 46 hpr from enterococcus faecalis
123. " " " " " "  = 1ptf:A *
The 1.6 angstroms structure of histidine-containing phosphotransfer protein hpr from streptococcus faecalis
124. 86 29.6% 71 729 114.1 22 2oce:A Crystal structure of tex family protein pa5201 from pseudomonas aeruginosa
125. 86 29.6% 71 730 114.1 22 3bzc:A Crystal structure of the tex protein from pseudomonas aeruginosa, crystal form i
126. 75 32.3% 65 89 113.9 23 1qfr:A Nmr solution structure of phosphocarrier protein hpr from enterococcus faecalis
127. 78 28.3% 53 171 113.4 24 2k8i:A Solution structure of e.Coli slyd
128. 83 31.1% 45 463 113.2 25 2ood:A Crystal structure of guanine deaminase from bradyrhizobium j
129. 78 28.3% 53 196 112.4 28 2kfw:A Solution structure of full-length slyd from e.Coli
130. 75 25.3% 91 151 110.2 37 3cgn:A Crystal structure of thermophilic slyd
131. 81 30.7% 75 483 110.1 37 3igh:X Crystal structure of an uncharacterized metal-dependent hydrolase from pyrococcus horikoshii ot3
132. 75 25.3% 91 157 109.9 38 3cgm:A Crystal structure of thermophilic slyd
133. 80 32.4% 68 330 108.7 44 2bi0:A Rv0216, a conserved hypothetical protein from mycobacterium tuberculosis that is essential for bacterial survival during infection, has a double hotdogfold
134. 75 25.9% 54 200 108.2 48 3emw:A Crystal structure of human spla/ryanodine receptor domain an containing 2 (spsb2) in complex with a 20-residue vasa pept
135. 78 28.4% 67 374 107.8 50 2du2:A Crystal structure analysis of the l-lactate oxidase

Number of sequences: 135

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer