spacer
spacer

SAS results for UniProt accession no. P80734

Sequence annotated by structure

Key:
Sec. struc: By homology Predicted
  Helix Strand   Helix Strand
Residue contacts:   to ligand   to metal
Active sites:   (from PDB SITE records)

Predicted secondary structure (green) comes from the DSC program. The lighter the green the less certain the prediction. Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P80734 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P80734 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 34 unique sequences (including 5 consensus sequences) giving 45 sequence matches in all. The 14 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P80734 -----------------------------------------------------------------   Superoxide dismutase [Ni] OS=Streptomyces seoulensis  ...
1q0d:A*-----------------------------------------------------------------×5 Crystal structure of ni-containing superoxide dismutase  ...
1t6u:A -----------------------------------------------------------------   Nickel superoxide dismutase (nisod) native 1.30 a structure
3g4x:A*-----------------------------------------------------------------×2 Crystal structure of nisod y9f mutant
3g50:A -----------------------------------------------------------------   Crystal structure of nisod d3a mutant at 1.9 a
1t6i:A -----------------------------------------------------------------   Nickel superoxide dismutase (nisod) apo structure
1t6q:A -----------------------------------------------------------------   Nickel superoxide dismutase (nisod) cn-treated apo structure
3o4x:A --------------------------------------rsammyiqelrsglrdmhllscleslr   Crystal structure of complex between amino and carboxy  ...
3obv:A ---------------------------------essrsammyiqelrsglrdmhllscleslrvs   Autoinhibited formin mdia1 structure
2bnx:A -----------------------------------srsammyiqelrsglrdmhllscleslrvs   Crystal structure of the dimeric regulatory domain of mouse  ...
1z2c:B vlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtsssrsammyiqelrsglrdmhllsc   Crystal structure of mdia1 gbd-fh3 in complex with rhoc-  ...
4gg6:D -----------------------------------------------------------------   Protein complex
4d8p:B -----------------------------------------------------------------   Structural and functional studies of the trans-encoded  ...
1j0r:A -----------------------------------------------------------------   Crystal structure of the replication termination protein  ...
1f4k:A*-----------------------------------------------------------------×4 Crystal structure of the replication terminator protein/b-  ...
1bm9:A -----------------------------------------------------------------   Replication terminator protein from bacillus subtilis
3pl6:B*-----------------------------------------------------------------×3 Structure of autoimmune tcr hy.1b11 in complex with hla-dq1  ...
1uvq:B -----------------------------------------------------------------   Crystal structure of hla-dq0602 in complex with a  ...
3p56:D -----------------------------------------------------------------   The structure of the human rnase h2 complex defines key  ...
4dh9:Y -----------------------------------------------------------------   Crystal structure of yaej bound to the 70s ribosome
1out:A*-----------------------------------------------------------------×2 Trout hemoglobin i

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P80734 -----------------------------------------------------------------   Superoxide dismutase [Ni] OS=Streptomyces seoulensis  ...
1q0d:A*-----------------------------------------------------------------×5 Crystal structure of ni-containing superoxide dismutase  ...
1t6u:A -----------------------------------------------------------------   Nickel superoxide dismutase (nisod) native 1.30 a structure
3g4x:A*-----------------------------------------------------------------×2 Crystal structure of nisod y9f mutant
3g50:A -----------------------------------------------------------------   Crystal structure of nisod d3a mutant at 1.9 a
1t6i:A -----------------------------------------------------------------   Nickel superoxide dismutase (nisod) apo structure
1t6q:A -----------------------------------------------------------------   Nickel superoxide dismutase (nisod) cn-treated apo structure
3o4x:A vslnnnpvswvqtfgaeglaslldilkrlhdekesgnydsrnqheiirclkafmnnkfgiktmle   Crystal structure of complex between amino and carboxy  ...
3obv:A lnnnpvswvqtfgaeglaslldilkrlhdekeetsgnydsrnqheiirclkafmnnkfgiktmle   Autoinhibited formin mdia1 structure
2bnx:A lnnnpvswvqtfgaeglaslldilkrlhdekeetsgnydsrnqheiirclkafmnnkfgiktmle   Crystal structure of the dimeric regulatory domain of mouse  ...
1z2c:B leslrvslnnnpvswvqtfgaeglaslldilkrlhdekdsrnqheiirclkafmnnkfgiktmle   Crystal structure of mdia1 gbd-fh3 in complex with rhoc-  ...
4gg6:D -----------------------------------------------------------------   Protein complex
4d8p:B -----------------------------------------------------------------   Structural and functional studies of the trans-encoded  ...
1j0r:A -----------------------------------------------------------------   Crystal structure of the replication termination protein  ...
1f4k:A*-----------------------------------------------------------------×4 Crystal structure of the replication terminator protein/b-  ...
1bm9:A -----------------------------------------------------------------   Replication terminator protein from bacillus subtilis
3pl6:B*-----------------------------------------------------------------×3 Structure of autoimmune tcr hy.1b11 in complex with hla-dq1  ...
1uvq:B -----------------------------------------------------------------   Crystal structure of hla-dq0602 in complex with a  ...
3p56:D -----------------------------------------------------------------   The structure of the human rnase h2 complex defines key  ...
4dh9:Y -----------------------------------------------------------------   Crystal structure of yaej bound to the 70s ribosome
1out:A*-----------------------------------------------------------------×2 Trout hemoglobin i

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P80734 -----------------------------------------------------------------   Superoxide dismutase [Ni] OS=Streptomyces seoulensis  ...
1q0d:A*-----------------------------------------------------------------×5 Crystal structure of ni-containing superoxide dismutase  ...
1t6u:A -----------------------------------------------------------------   Nickel superoxide dismutase (nisod) native 1.30 a structure
3g4x:A*-----------------------------------------------------------------×2 Crystal structure of nisod y9f mutant
3g50:A -----------------------------------------------------------------   Crystal structure of nisod d3a mutant at 1.9 a
1t6i:A -----------------------------------------------------------------   Nickel superoxide dismutase (nisod) apo structure
1t6q:A -----------------------------------------------------------------   Nickel superoxide dismutase (nisod) cn-treated apo structure
3o4x:A teegilllvramdpavpnmmidaakllsalcilpqpedmnervleamteraemdeverfqplldg   Crystal structure of complex between amino and carboxy  ...
3obv:A teegilllvramdpavpnmmidaakllsalcilpqpedmnervleamteraemdeverfqplldg   Autoinhibited formin mdia1 structure
2bnx:A teegilllvramdpavpnmmidaakllsalcilpqpedmnervleamteraemdeverfqplldg   Crystal structure of the dimeric regulatory domain of mouse  ...
1z2c:B teegilllvramdpavpnmmidaakllsalcilpqpedmnervleamteraemdeverfqplldg   Crystal structure of mdia1 gbd-fh3 in complex with rhoc-  ...
4gg6:D ------------------dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyr   Protein complex
4d8p:B ------pqpeqpeqpfpqpspedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefr   Structural and functional studies of the trans-encoded  ...
1j0r:A -----------------------------------------------------------------   Crystal structure of the replication termination protein  ...
1f4k:A*-----------------------------------------------------------------×4 Crystal structure of the replication terminator protein/b-  ...
1bm9:A -----------------------------------------------------------------   Replication terminator protein from bacillus subtilis
3pl6:B*-------------------spedfvyqfkglcyftngtervrgvtrhiynreeyvrfdsdvgvyr×3 Structure of autoimmune tcr hy.1b11 in complex with hla-dq1  ...
1uvq:B -------------------spedfvfqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyr   Crystal structure of hla-dq0602 in complex with a  ...
3p56:D -----------------------------------------------------------------   The structure of the human rnase h2 complex defines key  ...
4dh9:Y -----------------------------------------------------------------   Crystal structure of yaej bound to the 70s ribosome
1out:A*-----------------------------------------------------------------×2 Trout hemoglobin i

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P80734 -----------------------------------------mlsrlfapkvkvsahc-dlpc--g   Superoxide dismutase [Ni] OS=Streptomyces seoulensis  ...
1q0d:A*-------------------------------------------------------HC-DLPC--G×5 Crystal structure of ni-containing superoxide dismutase  ...
1t6u:A -------------------------------------------------------hc-dlpc--g   Nickel superoxide dismutase (nisod) native 1.30 a structure
3g4x:A*-------------------------------------------------------hc-dlpc--g×2 Crystal structure of nisod y9f mutant
3g50:A -------------------------------------------------------hc-alpc--g   Crystal structure of nisod d3a mutant at 1.9 a
1t6i:A ----------------------------------------------------------------g   Nickel superoxide dismutase (nisod) apo structure
1t6q:A ----------------------------------------------------------------g   Nickel superoxide dismutase (nisod) cn-treated apo structure
3o4x:A lksgtsialkvgclqlinalitpaeeldfrvhirselmrlglhqvlqelreienedm-kvql--c   Crystal structure of complex between amino and carboxy  ...
3obv:A lksgtsialkvgclqlinalitpaeeldfrvhirselmrlglhqvlqelreienedm-kvql--c   Autoinhibited formin mdia1 structure
2bnx:A lksgtsialkvgclqlinalitpaeeldfrvhirselmrlglhqvlqelreienedm-kvql--c   Crystal structure of the dimeric regulatory domain of mouse  ...
1z2c:B lksgtsialkvgclqlinalitpaeeldfrvhirselmrlglhqvlqelreienedm-kvql--c   Crystal structure of mdia1 gbd-fh3 in complex with rhoc-  ...
4gg6:D avtplgppaaeywnsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsl--lvc--s   Protein complex
4d8p:B avtllglpaaeywnsqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsn-llvc--s   Structural and functional studies of the trans-encoded  ...
1j0r:A -----------------------------------------------------------------   Crystal structure of the replication termination protein  ...
1f4k:A*-----------------------------------------------------------------×4 Crystal structure of the replication terminator protein/b-  ...
1bm9:A -----------------------------------------------------------------   Replication terminator protein from bacillus subtilis
3pl6:B*avtpqgrpvaeywnsqkevlegarasvdrvcrhnyevayrgilqrrveptvtispsn-llic--s×3 Structure of autoimmune tcr hy.1b11 in complex with hla-dq1  ...
1uvq:B avtpqgrpdaeywnsqkevlegtraeldtvcrhnyevafrgilqrrveptvtispsn-llvc--s   Crystal structure of hla-dq0602 in complex with a  ...
3p56:D ---------------------------------------ntgrcrlssp---vpavcrkepcvlg   The structure of the human rnase h2 complex defines key  ...
4dh9:Y --------------------------------------------------ivisrhv-aipd--g   Crystal structure of yaej bound to the 70s ribosome
1out:A*--sltakdksvvkafwgkisgkadvvgaealgrmltaypqtktyfshwadlspgsgp-vkkh--g×2 Trout hemoglobin i

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P80734 vyd--paqari------eaesvkai-qekmaanddlh--fqiratv-ike---qrael-akhhl-   Superoxide dismutase [Ni] OS=Streptomyces seoulensis  ...
1q0d:A*VYD--PAQARI------EAESVKAI-QEKMAANDDLH--FQIRATV-IKE---QRAEL-AKHHL-×5 Crystal structure of ni-containing superoxide dismutase  ...
1t6u:A vyd--paqari------eaesvkav-qekmagnddph--fqtratv-ike---qrael-akhhv-   Nickel superoxide dismutase (nisod) native 1.30 a structure
3g4x:A*vfd--paqari------eaesvkav-qekmagnddph--fqtratv-ike---qrael-akhhv-×2 Crystal structure of nisod y9f mutant
3g50:A vyd--paqari------eaesvkav-qekmagnddph--fqtratv-ike---qrael-akhhv-   Crystal structure of nisod d3a mutant at 1.9 a
1t6i:A vyd--paqari------eaesvkav-qekmagnddph--fqtratv-ike---qrael-akhhv-   Nickel superoxide dismutase (nisod) apo structure
1t6q:A vyd--paqari------eaesvkav-qekmagnddph--fqtratv-ike---qrael-akhhv-   Nickel superoxide dismutase (nisod) cn-treated apo structure
3o4x:A vfd--eqgded------ffdlkgrl-ddirmemddfgevfqiilnt-vkd---skae---phfl-   Crystal structure of complex between amino and carboxy  ...
3obv:A vfd--eqgded------ffdlkgrl-ddirmemddfgevfqiilnt-vkd---skae---phfl-   Autoinhibited formin mdia1 structure
2bnx:A vfd--eqgded------ffdlkgrl-ddirmemddfgevfqiilnt-vkd---skae---phfl-   Crystal structure of the dimeric regulatory domain of mouse  ...
1z2c:B vfd--eqgded------ffdlkgrl-ddirmemddfgevfqiilnt-vkd---skae---phfl-   Crystal structure of mdia1 gbd-fh3 in complex with rhoc-  ...
4gg6:D vtdfypaqikvrwf---qeettgvv-stplirngdwt--fqi--lv-mle---mrgdv-ytchv-   Protein complex
4d8p:B vtdfypaqikvrwfrndqeetagvv-stplirngdwt--fqilvmlemtp---qrgdv-ytchv-   Structural and functional studies of the trans-encoded  ...
1j0r:A ---------------------------tgflvkqraf--lklymit-mte---qerly-glkll-   Crystal structure of the replication termination protein  ...
1f4k:A*--------------------------stgflvkqraf--lklymit-mte---qerly-glkll-×4 Crystal structure of the replication terminator protein/b-  ...
1bm9:A --------------------eekrs-stgflvkqraf--lklymit-mte---qerly-glkll-   Replication terminator protein from bacillus subtilis
3pl6:B*vtdfypsqikvrwfrndqeetagvv-stplirngdwt--fqilvmlemtp---qrgdv-ytchv-×3 Structure of autoimmune tcr hy.1b11 in complex with hla-dq1  ...
1uvq:B vtdfypgqikvrwfrndqeetagvv-stplirngdwt--fqilvmlemtp---qrgdv-ytchv-   Crystal structure of hla-dq0602 in complex with a  ...
3p56:D vae--agrgpv------lgpmvyaicycplprladle--alkvatl-les---ererlfakmed-   The structure of the human rnase h2 complex defines key  ...
4dh9:Y ele--itaira------qgaggqhv-n-ktstaihlr--fdirass-lpeyykerlla-ashhli   Crystal structure of yaej bound to the 70s ribosome
1out:A*gii--mgaigk------avglmddl-vggmsalsdlha-fklr----vdp---gnfki-lshni-×2 Trout hemoglobin i

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P80734 --d---vlwsdy----fkpphfesypelhtlvneavkalsaakastdpatg--qkaldyiaqidk   Superoxide dismutase [Ni] OS=Streptomyces seoulensis  ...
1q0d:A*--D---VLWSDY----FKPPHFESYPELHTLVNEAVKALSAAKASTDPATG--QKALDYIAQIDK×5 Crystal structure of ni-containing superoxide dismutase  ...
1t6u:A --s---vlwsdy----fkpphfekypelhqlvndtlkamsaakgskdpatg--qkaldyiaqidk   Nickel superoxide dismutase (nisod) native 1.30 a structure
3g4x:A*--s---vlwsdy----fkpphfekypelhqlvndtlkalsaakgskdpatg--qkaldyiaqidk×2 Crystal structure of nisod y9f mutant
3g50:A --s---vlwsdy----fkpphfekypelhqlvndtlkalsaakgskdpatg--qkaldyiaqidk   Crystal structure of nisod d3a mutant at 1.9 a
1t6i:A --s---vlwsdy----fkpphfekypelhqlvndtlkamsaakgskdpatg--qkaldyiaqidk   Nickel superoxide dismutase (nisod) apo structure
1t6q:A --s---vlwsdy----fkpphfekypelhqlvndtlkamsaakgskdpatg--qkaldyiaqidk   Nickel superoxide dismutase (nisod) cn-treated apo structure
3o4x:A --s---ilqhll----lvrndyearpqyyklieecvsqivlhkngtdpdfk--crhlqidi----   Crystal structure of complex between amino and carboxy  ...
3obv:A --s---ilqhll----lvrndyearpqyyklieecvsqivlhkngtdpdfk--crhlqidi----   Autoinhibited formin mdia1 structure
2bnx:A --s---ilqhll----lvrndyearpqyyklieecvsqivlhkngtdpdfk--crhlqidierlv   Crystal structure of the dimeric regulatory domain of mouse  ...
1z2c:B --s---ilqhll----lvrndyearpqyyklieecvsqivlhkngtdpdf---------------   Crystal structure of mdia1 gbd-fh3 in complex with rhoc-  ...
4gg6:D --e---hpslqn----piivewr------------------------------------------   Protein complex
4d8p:B --e---hpslqs----pitvewra-----------------------------------------   Structural and functional studies of the trans-encoded  ...
1j0r:A --e---vlrsefkeigfkpnhtevyrslhellddgi--lkqikvkkegakl--qevvlyqfkdye   Crystal structure of the replication termination protein  ...
1f4k:A*--e---vlrsefkeigfkpnhtevyrslhellddgi--lkqikvkkegakl--qevvlyqfkdye×4 Crystal structure of the replication terminator protein/b-  ...
1bm9:A --e---vlrsefkeigfkpnhtevyrslhellddgi--lkqikvkkegakl--qevvlyqfkdye   Replication terminator protein from bacillus subtilis
3pl6:B*--e---hpslqs----pitvewraq----------------------------------------×3 Structure of autoimmune tcr hy.1b11 in complex with hla-dq1  ...
1uvq:B --e---hpslqs----pitvewraq----------------------------------------   Crystal structure of hla-dq0602 in complex with a  ...
3p56:D --f---vgwald----vlspnlistsmlgr-vkynlnslsh-----dtatgliqyaldqgvnvtq   The structure of the human rnase h2 complex defines key  ...
4dh9:Y ssdgvivikaqe----yrsqelnreaalarlva-mikelttekkarrptrp--traskerrlask   Crystal structure of yaej bound to the 70s ribosome
1out:A*--l---vtlaih----f-psdft--pevhiavdkflaavsaaladkyr-----------------×2 Trout hemoglobin i

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P80734 ifwetkka---------------------------------------------------------   Superoxide dismutase [Ni] OS=Streptomyces seoulensis  ...
1q0d:A*IFWETKKA---------------------------------------------------------×5 Crystal structure of ni-containing superoxide dismutase  ...
1t6u:A ifwetkka---------------------------------------------------------   Nickel superoxide dismutase (nisod) native 1.30 a structure
3g4x:A*ifwetkka---------------------------------------------------------×2 Crystal structure of nisod y9f mutant
3g50:A ifwetkka---------------------------------------------------------   Crystal structure of nisod d3a mutant at 1.9 a
1t6i:A ifwetkka---------------------------------------------------------   Nickel superoxide dismutase (nisod) apo structure
1t6q:A ifwetkk----------------------------------------------------------   Nickel superoxide dismutase (nisod) cn-treated apo structure
3o4x:A -----------------------------------------------------------------   Crystal structure of complex between amino and carboxy  ...
3obv:A -----------------------------------------------------------------   Autoinhibited formin mdia1 structure
2bnx:A ktkvekseakatel---------------------------------------------------   Crystal structure of the dimeric regulatory domain of mouse  ...
1z2c:B -----------------------------------------------------------------   Crystal structure of mdia1 gbd-fh3 in complex with rhoc-  ...
4gg6:D -----------------------------------------------------------------   Protein complex
4d8p:B -----------------------------------------------------------------   Structural and functional studies of the trans-encoded  ...
1j0r:A aaklykkqlkveldrskkliekalsdnf-------------------------------------   Crystal structure of the replication termination protein  ...
1f4k:A*aaklykkqlkveldrskkliekalsdnf-------------------------------------×4 Crystal structure of the replication terminator protein/b-  ...
1bm9:A aaklykkqlkveldrckkliekalsdnf-------------------------------------   Replication terminator protein from bacillus subtilis
3pl6:B*-----------------------------------------------------------------×3 Structure of autoimmune tcr hy.1b11 in complex with hla-dq1  ...
1uvq:B -----------------------------------------------------------------   Crystal structure of hla-dq0602 in complex with a  ...
3p56:D vfvdtkaaalypvvsaasicakvardqavkkwqdygsgypndpktkawlkehvepvfgfpqfvrf   The structure of the human rnase h2 complex defines key  ...
4dh9:Y aqkssvkamrg------------------------------------------------------   Crystal structure of yaej bound to the 70s ribosome
1out:A*-----------------------------------------------------------------×2 Trout hemoglobin i

           4         4         4         4  
           6         7         8         9  
       6789012345678901234567890123456789012                               Protein name
       ----+---------+---------+---------+--                               ------------
P80734 -------------------------------------                               Superoxide dismutase [Ni] OS=Streptomyces seoulensis  ...
1q0d:A*-------------------------------------                            ×5 Crystal structure of ni-containing superoxide dismutase  ...
1t6u:A -------------------------------------                               Nickel superoxide dismutase (nisod) native 1.30 a structure
3g4x:A*-------------------------------------                            ×2 Crystal structure of nisod y9f mutant
3g50:A -------------------------------------                               Crystal structure of nisod d3a mutant at 1.9 a
1t6i:A -------------------------------------                               Nickel superoxide dismutase (nisod) apo structure
1t6q:A -------------------------------------                               Nickel superoxide dismutase (nisod) cn-treated apo structure
3o4x:A -------------------------------------                               Crystal structure of complex between amino and carboxy  ...
3obv:A -------------------------------------                               Autoinhibited formin mdia1 structure
2bnx:A -------------------------------------                               Crystal structure of the dimeric regulatory domain of mouse  ...
1z2c:B -------------------------------------                               Crystal structure of mdia1 gbd-fh3 in complex with rhoc-  ...
4gg6:D -------------------------------------                               Protein complex
4d8p:B -------------------------------------                               Structural and functional studies of the trans-encoded  ...
1j0r:A -------------------------------------                               Crystal structure of the replication termination protein  ...
1f4k:A*-------------------------------------                            ×4 Crystal structure of the replication terminator protein/b-  ...
1bm9:A -------------------------------------                               Replication terminator protein from bacillus subtilis
3pl6:B*-------------------------------------                            ×3 Structure of autoimmune tcr hy.1b11 in complex with hla-dq1  ...
1uvq:B -------------------------------------                               Crystal structure of hla-dq0602 in complex with a  ...
3p56:D swrtaqtilekeaedviwedsshryflerglesatsl                               The structure of the human rnase h2 complex defines key  ...
4dh9:Y -------------------------------------                               Crystal structure of yaej bound to the 70s ribosome
1out:A*-------------------------------------                            ×2 Trout hemoglobin i

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P80734. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 131 - - P80734 Superoxide dismutase [Ni] OS=Streptomyces seoulensis GN=sodN PE=1 SV=2
2. 782 100.0% 117 117 1051.0 1.4e-51 1q0d:A * Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the oxidized state
3. " " " " " "  = 1q0f:A *
Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after partial x-ray-induced reduction
4. " " " " " "  = 1q0g:A *
Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after full x- ray-induced reduction
5. " " " " " "  = 1q0k:A *
Crystal structure of ni-containing superoxide dismutase with ligation corresponding to the thiosulfate-reduced state
6. " " " " " "  = 1q0m:A *
Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after full x- ray-induced reduction
7. 712 88.0% 117 117 957.8 2.3e-46 1t6u:A Nickel superoxide dismutase (nisod) native 1.30 a structure
8. 710 88.0% 117 117 955.1 3.2e-46 3g4x:A * Crystal structure of nisod y9f mutant
9. " " " " " "  = 3g4z:A *
Crystal structure of nisod y9f mutant at 1.9 a
10. 704 88.0% 117 117 947.1 8.8e-46 3g50:A Crystal structure of nisod d3a mutant at 1.9 a
11. 653 87.4% 111 111 879.6 5.1e-42 1t6i:A Nickel superoxide dismutase (nisod) apo structure
12. 648 87.3% 110 110 873.0 1.2e-41 1t6q:A Nickel superoxide dismutase (nisod) cn-treated apo structure
13. 98 30.8% 65 317 133.1 1.9 3o4x:A Crystal structure of complex between amino and carboxy termi fragments of mdia1
14. 98 30.8% 65 322 133.0 2 3obv:A Autoinhibited formin mdia1 structure
15. 98 30.8% 65 338 132.7 2 2bnx:A Crystal structure of the dimeric regulatory domain of mouse diaphaneous-related formin (drf), mdia1
16. 98 30.8% 65 346 132.5 2.1 1z2c:B Crystal structure of mdia1 gbd-fh3 in complex with rhoc- gmppnp
17. 88 29.7% 74 173 123.9 6.3 4gg6:D Protein complex
18. 87 26.9% 78 193 121.9 8.2 4d8p:B Structural and functional studies of the trans-encoded hla-d (dqa1 03:01/Dqb1 02:01) Molecule
19. 84 27.8% 72 114 121.5 8.6 1j0r:A Crystal structure of the replication termination protein mutant c110s
20. 84 27.8% 72 115 121.4 8.7 1f4k:A * Crystal structure of the replication terminator protein/b- site DNA complex
21. " " " " " "  = 2dpd:A *
Crystal structure of the replication termination protein in complex with a pseudosymmetric b-site
22. " " " " " "  = 2dpu:A *
Crystal structure of the replication termination protein in complex with a pseudosymmetric 21mer b-site DNA
23. " " " " " "  = 2efw:A *
Crystal structure of the rtp:nrb complex from bacillus subti
24. 84 27.8% 72 120 121.1 9 1bm9:A Replication terminator protein from bacillus subtilis
25. 85 25.3% 79 181 119.6 11 3pl6:B * Structure of autoimmune tcr hy.1b11 in complex with hla-dq1 85-99
26. " " " " " "  = 4grl:B *
Crystal structure of a autoimmune tcr-mhc complex
27. " " " " " "  = 4may:B *
Crystal structure of an immune complex
28. 84 25.3% 79 181 118.3 13 1uvq:B Crystal structure of hla-dq0602 in complex with a hypocretin peptide
29. 85 30.4% 135 225 118.1 13 3p56:D The structure of the human rnase h2 complex defines key inte interfaces relevant to enzyme function and human disease
30. 82 23.7% 114 132 117.8 14 4dh9:Y Crystal structure of yaej bound to the 70s ribosome
31. 79 32.8% 64 142 113.3 25 1out:A * Trout hemoglobin i
32. " " " " " "  = 1ouu:A *
Carbonmonoxy trout hemoglobin i

Number of sequences: 32

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 80 31.6% 79 177 113.1 25 2i9w:A Crystal structure of a sec-c motif containing protein (psyc_ psychrobacter arcticus at 1.75 a resolution
2. 78 24.1% 108 121 113.1 25 2rtx:A Solution structure of the ggq domain of yaej protein from es coli
3. 77 29.4% 51 108 112.5 27 2efw:G Crystal structure of the rtp:nrb complex from bacillus subti
4. 77 27.8% 72 112 112.3 28 2dqr:B Crystal structure of the replication terminator protein mutant rtp.E39k.R42q
5. 77 31.4% 70 123 111.6 31 2k54:A Solution nmr structure of protein atu0742 from agrobacterium tumefaciens. Northeast structural genomics consortium (nesg att8. Ontario center for structural proteomics target atc07
6. 76 29.4% 51 106 111.3 32 2dqr:C Crystal structure of the replication terminator protein mutant rtp.E39k.R42q
7. 76 29.4% 51 107 111.2 32 2dqr:A Crystal structure of the replication terminator protein mutant rtp.E39k.R42q
8. 85 24.3% 107 355 111.0 33 4kqv:A Topoisomerase iv atp binding domain of francisella tularensi complex with a small molecule inhibitor
9. 85 24.3% 107 366 110.8 34 4hxz:A Pyrrolopyrimidine inhibitors of DNA gyrase b and topoisomera part i: structure guided discovery and optimization of dual agents with potent, broad-spectrum enzymatic activity.
10. 79 30.0% 50 212 110.6 35 2h1i:A Crystal structure of the bacillus cereus carboxylesterase
11. 77 26.9% 78 182 108.9 43 2nna:B Structure of the mhc class ii molecule hla-dq8 bound with a gluten peptide
12. 78 29.8% 94 241 108.4 46 3kfv:A Crystal structure of the sh3-kinase fragment of tight junction protein 3 (tjp3) in apo-form
13. 76 33.3% 54 163 108.4 46 4gg6:B Protein complex
14. 80 25.5% 102 380 107.9 49 2imr:A Crystal structure of amidohydrolase dr_0824 from deinococcus radiodurans

Number of sequences: 14

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer