spacer
spacer

SAS results for UniProt accession no. P23657

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand   to DNA/RNA   to metal
Catalytic residues:   (from CSA)
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P23657 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P23657 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 18 unique sequences (including 2 consensus sequences) giving 21 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P23657 -----------------------------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-----------------------------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -----------------------------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A -----------------------------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -----------------------------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -----------------------------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A -----------------------------------------------------------------   Crystal structure of single chain pvuii
1k0z:A -----------------------------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -----------------------------------------------------------------   Generation and characterization of a unique reagent that  ...
3h1t:A -----------------------------------------------------------------   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A -----------------------------------------------------------------   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A -----------------------------------------------------------------   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A -----------------------------------------------------------------   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-----------------------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A evptatsvraipaklmidnrvvinnhlkrtrggkisfthllgyaivqavkkfpnmnrhfavvdgk   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A -----------------------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P23657 -----------------------------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-----------------------------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -----------------------------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A -----------------------------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -----------------------------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -----------------------------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A -----------------------------------------------------------------   Crystal structure of single chain pvuii
1k0z:A -----------------------------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -----------------------------------------------------------------   Generation and characterization of a unique reagent that  ...
3h1t:A -----------------------------------------------------------------   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A -----------------------------------------------------------------   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A -----------------------------------------------------------------   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A -----------------------------------------------------------------   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-----------------------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A ptaitpahtnlglaivvaaikrcetmrfgqfiaayedivrrardgkltaedfsgvtisltnpmqg   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A -----------------------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P23657 -----------------------------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-----------------------------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -----------------------------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A -----------------------------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -----------------------------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -----------------------------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A -----------------------------------------------------------------   Crystal structure of single chain pvuii
1k0z:A -----------------------------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -----------------------------------------------------------------   Generation and characterization of a unique reagent that  ...
3h1t:A -----------------------------------------------------------------   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A -----------------------------------------------------------------   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A -----------------------------------------------------------------   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A -----------------------------------------------------------------   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-----------------------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A qgaiigagameypaefqgaseeriadlgigklitltstydhriiqgaesgdflrtihqllldddf   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A -----------------------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P23657 -----------------------------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-----------------------------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -----------------------------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A -----------------------------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -----------------------------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -----------------------------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A -----------------------------------------------------------------   Crystal structure of single chain pvuii
1k0z:A -----------------------------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -----------------------------------------------------------------   Generation and characterization of a unique reagent that  ...
3h1t:A -----------------------------------------------------------------   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A ----------------------------------knarvieliaayrnrghlmadidplrldntr   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A --------------------------------------knarvieliaayrnrghlmadidplrl   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A -----------------------------------------------------------------   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-----------------------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A fdeifrelgipyepvrwrtdnpdsiedknarvieliaayrnrghlmadidplrldntrfrshpdl   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A -----------------------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P23657 -----------------------------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-----------------------------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -----------------------------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A -----------------------------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -----------------------------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -----------------------------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A -----------------------------------------------------------------   Crystal structure of single chain pvuii
1k0z:A -----------------------------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -----------------------------------------------------------------   Generation and characterization of a unique reagent that  ...
3h1t:A -----------------------------------------------------------------   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A frshpdldvnshgltlwdldrefkvqrkklrdilsvlrdaycrhvgveythilepeqqrwiqerv   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A dntrfrltlwdldrefkqrkklrdilsvlrdaycrhvgveythilepeqqrwiqervetkhdkpt   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A -----------------------------------------------------------------   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-----------------------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A dvnshgltlwdldrefkvdgfagvqrkklrdilsvlrdaycrhvgveythilepeqqrwiqerve   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A -----------------------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P23657 -----------------------------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-----------------------------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -----------------------------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A -----------------------------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -----------------------------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -----------------------------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A -----------------------------------------------------------------   Crystal structure of single chain pvuii
1k0z:A -----------------------------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -----------------------------------------------------------------   Generation and characterization of a unique reagent that  ...
3h1t:A -----------------------------------------------------------------   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A etkhdkptvaeqkyilsklnaaeafetflqtkyvgqkrfslegaetvipmmdavidqcaehglde   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A vaeqkyilsklnaaeafetflqtkyvgqkrfslegaetvipmmdavidqcaehgldevviamphr   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A -----------------------------------------------------------------   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-----------------------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A tkhdkptvaeqkyilsklnaaeafetflqtkyvgqkrfslegaetvipmmdavidqcaehgldev   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A -----------------------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P23657 -----------------------------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-----------------------------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -----------------------------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A -----------------------------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -----------------------------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -----------------------------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A ------------------------------------------------------------SHPDL   Crystal structure of single chain pvuii
1k0z:A -----------------------------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -----------------------------------------------------------------   Generation and characterization of a unique reagent that  ...
3h1t:A -----------------------------------------------------------------   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A vviamphrgrlnvlanivgkpysqifsedvkyhlgatgtyiqmfgdndievsltanpshleavdp   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A grlnvlanivgkpysqifsefeqahgsgdvkyhlgatgtyiqmfgdndievsltanpshleavdp   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A -----------------------------------------------------------------   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-----------------------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A viamphrgrlnvlanivgkpysqifsefdvkyhlgatgtyiqmfgdndievsltanpshleavdp   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A -----------------------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P23657 -----------------------------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-----------------------------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -----------------------------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A -----------------------------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -----------------------------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -----------------------------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A NKLLELWPHIQEYQDLALKHGINDIFQDNGGKLLQVLLITGLTVLPGNDAVDNAGQEYELKSINI   Crystal structure of single chain pvuii
1k0z:A -----------------------------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -----------------------------------------------------------------   Generation and characterization of a unique reagent that  ...
3h1t:A -------------smalneadtcrvyvtpklkesgwennpsaiteqytftdgrvqfkgskvqrge   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A vleglvrakqdlldtgeegsdnrfsvvplmlhgdaafagqgvvaetlnlallrgyrtggtihivv   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A vleglvrakqdlldtgeegsdnrfsvvplmlhgdaafagqgvvaetlnlallrgyrtggtihivv   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A -----------------------------------------------------------------   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-----------------------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A vleglvrakqdlldtgeegsdnrfsvvplmlhgdaafagqgvvaetlnlallrgyrtggtihivv   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A -----------------------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P23657 -----------------------------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-----------------------------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -----------------------------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A -----------------------------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -----------------------------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -----------------------------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A DLTKGFSTHHHMNPVIIAKYRQVPWIFAIYRGIAIEAIYRLEPKDLEFYYDKWERKWYSDGHKDI   Crystal structure of single chain pvuii
1k0z:A -----------------------------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -----------------------------------------------------------------   Generation and characterization of a unique reagent that  ...
3h1t:A qkradyllkytrdfpiavveakpenspvgqgmqqakdyaeilglkfaystngheilefdyttgee   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A nnqigfttaptdsrsseyctdvakmigapifhvngddpeacawvarlavdfrqafkkdvvidmlc   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A nnqigfttaptdsrsseyctdvakmigapifhvngddpeacawvarlavdfrqafkkdvvidmlc   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A -----------------------------------------------------------------   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-----------------------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A nnqigfttaptdsrsseyctdvakmigapifhvngddpeacawvarlavdfrqafkkdvvidmlc   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A -----------------------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P23657 ---------------------mshpdlnkllelwphiqey-qdlalkhgindifqdng--gkl-l   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*----------------------shpdlnkllelwphiqey-qdlalkhgindifqdng--gkl-l×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A ----------------------shpdlnkllelwphiqey-qdlalkhgindifqgng--gkl-l   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------hpdlnkllelwphiqey-qdlalkhgindifqdng--gkl-l   Structure of the y94f mutant of the restriction  ...
2pvi:A ----------------------shpdlnkllelwphiqey-qdlalkhgindifqdng--gkl-l   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A ----------------------shpdlnkllelwphiqey-qdlalkhgindifqdng--gkl-l   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A ----------------------shpdlnkllelwphiqey-qdlalkhgindifqdng--gkl-l   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A NNPKIPVKYVMEHGTKIYGSGGSHPDLNKLLELWPHIQEY-QDLALKHGINDIFQDNG--GKL-L   Crystal structure of single chain pvuii
1k0z:A -------------------------DLNKLLELWPHIQEY-QDLALKHGINDIFQDNG--GKL-L   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -----------------diqmtqspaslsasvgetvtitc-raseniysylawyqqkq--gks-p   Generation and characterization of a unique reagent that  ...
3h1t:A qllsrfptpdelfkrlcgdegikdedldtllspyhhvpryyqqiainravqsvlqgkk--rsl-i   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A yrrrghnegddpsmtqpymydvidtkrgsrkaytealigr-gdismkea-edalrdyq--gql-e   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A yrrrganegddpsmtqpymydvidtkrgsrkaytealigr-gdismkea-edalrdyq--gql-e   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A ----------------------------------------------------------------m   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*------egravltsktvkdfmlqklnsldikgnaskdpay-arqtceailsavysnnk--dqc-c×2 Solution structure of the catalytic domain of sope2
2xt6:A yrrrghnegddpsmtqpymydvidtkrgsrkaytealigr-gdismkea-edalrdyq--gql-e   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A neseiierlnsapsvrgffiatvdvfnesidgliqrifrk-dnfavqsvvgpllqdsgplgdlsv   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------mkpfllgllkckrcsfmtklilecekaes-ndvdvkifnkhmfteng--ger-l   Structure of eukaryotic translation termination complex  ...

                6         6         6         6         7         7     
                6         7         8         9         0         1     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P23657 qvllitgltvlpg-r---egnda-----vdnagqeyelksi--ni---dltkgfsthhhmnpvi-   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*qvllitgltvlpg-r---egnda-----vdnagqeyelksi--ni---dltkgfsthhhmnpvi-×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A qvllitgltvlpg-r---egnda-----vdnagqeyelksi--ni---dltkgfsthhhmnpvi-   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A qvllitgltvlpg-r---egnda-----vdnagqeyelksi--ni---dltkgfsthhhmnpvi-   Structure of the y94f mutant of the restriction  ...
2pvi:A qvllitgltvlpg-r---agnda-----vdnagqeyelksi--ni---dltkgfsthhhmnpvi-   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A qvllitgltvlpg------gnda-----vdnagqeyelksi--ni---dltkgfsthhhmnpvi-   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A qvllitgltvlp------egnda-----vdnagqeyelksi--ni---dltkgfsthhhmnpvi-   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A QVLLITGLTVLPG------GNDA-----VDNAGQEYELKSI--NI---DLTKGFSTHHHMNPVI-   Crystal structure of single chain pvuii
1k0z:A QVLLITGLTVLPG------GNDA-----VDNAGQEYELKSI--NI---DLTKGFSTHHHMNPVI-   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L qllvynaktlaeg-v---psrfs-----gsgsgtqfslkin--nlqpedfgsyycqhhyvtpvt-   Generation and characterization of a unique reagent that  ...
3h1t:A tmatgtgktvvaf-qiswklwsa-----rwnrtgdyrkpri--lfla-dtftpfgdarhkiegv-   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A rvf--nevrelek-h---elata-----vdkamlq-rigda--hl---alpegftvhprvrpvle   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A rvf--nevrelek-h---elata-----vdkamlq-rigda--hl---alpegftvhprvrpvle   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A iklvfrysptktv-d---gfnel-----afglgdglpwgrv--kk---dlqnfkartegtimim-   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*klliskgvsitpflk---eigea-----aqnaglpgeikn---gv---ftpggaganpfvvpli-×2 Solution structure of the catalytic domain of sope2
2xt6:A rvf--nevrelek-h---elata-----vdkamlq-rigda--hl---alpegftvhprvrpvle   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -------------------------------------------------------------gst-   The mengovirus leader protein
3brj:A rlkllfglgvlp--------ddi-----yhdiediiklkn--------hlnsdasdyeftdpni-   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A ksl-vnslrdfhg-r---elseqdissfvenpgddekikeflfgi---dvvegslrcdmcgliy-   Structure of eukaryotic translation termination complex  ...

           7         7         7         7         7         7         7
           2         3         4         5         6         7         8
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P23657 ----iak-yrqvpwifaiyrgiaieaiyrlep----kdlefyydkwer--kwy-----sdghkdi   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*----iak-yrqvpwifaiyrgiaieaiyrlep----kdlefyydkwer--kwy-----sdghkdi×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A ----iak-yrqvpwifaiyrgiaieaiyrlep----kdlefyydkwer--kwy-----sdghkdi   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A ----iak-frqvpwifaiyrgiaieaiyrlep----kdlefyydkwer--kwy-----sdghkdi   Structure of the y94f mutant of the restriction  ...
2pvi:A ----iak-arqvpwifaiyrgiaieaiyrlep----kdlefyydkwer--kwy-----sdghkdi   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A ----iak-yrqvpwifaiyrgiaieaiyrlep----kdlefyydkwer--kwy-----sdghkdi   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A ----iak-yrqvpwifaiyrgiaieaiyrlep----kdlefyydkwer--kwy-----sdghkdi   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A ----IAK-YRQVPWIFAIYRGIAIEAIYRLEP----KDLEFYYDKWER--KWY-----SDGHKDI   Crystal structure of single chain pvuii
1k0z:A ----IAK-YRQVPWIFAIYRGIAIEAIYRLEP----KDLEFYYDKWER--KWY-----SDGHKDI   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L ----fga-gtkld----lkrtvaapsvfifpp----sdeqlksgtasv--vcl-----lnnfypr   Generation and characterization of a unique reagent that  ...
3h1t:A ----v-k-srei--yfaiyq--sipglykefp----qdffdliiidec--hwr-----eileyfe   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A krremay-egridwafaellalgsliaegklv----rlsgqdtqrgtf--tqr-----havivdr   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A krremay-egridwafaellalgsliaegklv----rlsgqdtqrgtf--tqr-----havivdr   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A ----gaktfqslptllpgrshivvcdlardypvtkdgdlahfyitweqyityi-----sggeiqv   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*----asa-sikyphmfinhnqqvsfkayaeki----vmkevtplfnkg--tmp-----tpqqfql×2 Solution structure of the catalytic domain of sope2
2xt6:A krremay-egridwafaellalgsliaegklv----rlsgqdtqrgtf--tqr-----havivdr   Crystal structure of mycobacterium smegmatis  ...
2m7y:A ----ama-ttmeqeicahsmtfeecpkcsalq----yrngfyllkyde--ewypeelltdgeddv   The mengovirus leader protein
3brj:A ----lep-ikklhlvkkmgm-vqlevnepddd----idlefyqlqlqr--qqq-----iiksgls   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A ----pik-gsivetvdtvesk--------------------------------------------   Structure of eukaryotic translation termination complex  ...

                7         8         8         8         8         8     
                9         0         1         2         3         4     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P23657 nnpkipvkyvmehgtkiy-----------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*nnpkipvkyvmehgtkiy-----------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A nnpkipvkyvmehgtkiy-----------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A nnpkipvkyvmehgtkiyaa---------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A nnpkipvkyvmehgtkiy-----------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A nnpkipvkyvmehgtkiy-----------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A nnpkipvkyvmehgtkiy-----------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A NNPKIPVKYVMEHGTKIYGS---------------------------------------------   Crystal structure of single chain pvuii
1k0z:A NNPKIPVKYVMEHGTKIY-----------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L eakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtk   Generation and characterization of a unique reagent that  ...
3h1t:A pafqigmtatplrednrdtyryfgnpiytyslrqgiddgflapyrvhrvisevdatkdfervial   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A ktgeeftplqllatnpdgtptggkflvynsalsefaavgfeygysvgnpdamvlweaqfgdfvng   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A ktgeeftplqllatnpdgtptggkflvynsalsefaavgfeygysvgnpdamvlweaqfgdfvng   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A sspnapfetmldqnskvsviggpallyaalpyadevvvsrivkrhrvnstvqldasflddiskre   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*tieniankylqnas---------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A ktgeeftplqllatnpdgtptggkflvynsalsefaavgfeygysvgnpdamvlweaqfgdfvng   Crystal structure of mycobacterium smegmatis  ...
2m7y:A fdpdldmevvfetq---------------------------------------------------   The mengovirus leader protein
3brj:A laiveicnelgk-----------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

           8         8         8         8         8         9         9
           5         6         7         8         9         0         1
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P23657 -----------------------------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-----------------------------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -----------------------------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A -----------------------------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -----------------------------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -----------------------------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A -----------------------------------------------------------------   Crystal structure of single chain pvuii
1k0z:A -----------------------------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L sfnrgec----------------------------------------------------------   Generation and characterization of a unique reagent that  ...
3h1t:A kartdafakhltdfmkrtdrfaktivfcvdqehademrralnnlnsdlsrkhpdyvarvtseegk   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A aqsiidefissgeakwgqlsdvvlllphghegqgpdhtsgrierflqlwaegsmtiampstpany   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A aqsiidefissgeakwgqlsdvvlllphghegqgpdhtsgrierflqlwaegsmtiampstpany   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A mvethwykidevttltesvyk--------------------------------------------   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-----------------------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A aqsiidefissgeakwgqlsdvvlllphghegqgpdhtsgrierflqlwaegsmtiampstpany   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A -----------------------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

                9         9         9         9         9         9     
                2         3         4         5         6         7     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P23657 -----------------------------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-----------------------------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -----------------------------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A -----------------------------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -----------------------------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -----------------------------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A -----------------------------------------------------------------   Crystal structure of single chain pvuii
1k0z:A -----------------------------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -----------------------------------------------------------------   Generation and characterization of a unique reagent that  ...
3h1t:A igkghlsrfqeletstpvilttsqllttgvdaptcknvvlarvvnsmsefkqivgrgtrlredyg   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A fhllrrhgkdgiqrplivftpksmlrnkaavsdirdfteskfrsvleepmytdgegdrnkvtrll   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A fhllrrhgkdgiqrplivftpksmlrnkaavsdirdfteskfrsvleepmytdgegdrnkvtrll   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A -----------------------------------------------------------------   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-----------------------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A fhllrrhgkdgiqrplivftpksmlrnkaavsdirdfteskfrsvleepmytdgegdrnkvtrll   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A -----------------------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

                               1         1         1         1         1
           9         9         0         0         0         0         0
           8         9         0         1         2         3         4
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P23657 -----------------------------------------------------------------   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-----------------------------------------------------------------×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -----------------------------------------------------------------   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -----------------------------------------------------------------   Structure of the y94f mutant of the restriction  ...
2pvi:A -----------------------------------------------------------------   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -----------------------------------------------------------------   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -----------------------------------------------------------------   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A -----------------------------------------------------------------   Crystal structure of single chain pvuii
1k0z:A -----------------------------------------------------------------   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -----------------------------------------------------------------   Generation and characterization of a unique reagent that  ...
3h1t:A klwfniidytgsatqnfadpdfdgypeiedevvidedgeevv-----------------------   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A ltsgkiyyelaarkakenredvaivrieqlaplprrrlaetldrypnvkekfwvqeepanqgawp   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A ltsgkiyyelaarkakenredvaivrieqlaplprrrlaetldrypnvkekfwvqeepanqgawp   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A -----------------------------------------------------------------   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-----------------------------------------------------------------×2 Solution structure of the catalytic domain of sope2
2xt6:A ltsgkiyyelaarkakenredvaivrieqlaplprrrlaetldrypnvkekfwvqeepanqgawp   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -----------------------------------------------------------------   The mengovirus leader protein
3brj:A -----------------------------------------------------------------   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -----------------------------------------------------------------   Structure of eukaryotic translation termination complex  ...

                1         1         1         1         
                0         0         0         0         
                5         6         7         8         
       1234567890123456789012345678901234567890123456789                   Protein name
       ---------+---------+---------+---------+---------                   ------------
P23657 -------------------------------------------------                   Type-2 restriction enzyme PvuII OS=Proteus hauseri  ...
1eyu:A*-------------------------------------------------                ×3 High resolution structure of the pvuii endonculease/cognate  ...
3pvi:A -------------------------------------------------                   D34g mutant of pvuii endonuclease complexed with cognate  ...
1ni0:A -------------------------------------------------                   Structure of the y94f mutant of the restriction  ...
2pvi:A -------------------------------------------------                   Pvuii endonuclease complexed to an iodinated cognate DNA
1pvu:A -------------------------------------------------                   The crystal structure of pvuii endonuclease reveals  ...
1f0o:A -------------------------------------------------                   Pvuii endonuclease/cognate DNA complex (glutaraldehyde-  ...
3ksk:A -------------------------------------------------                   Crystal structure of single chain pvuii
1k0z:A -------------------------------------------------                   Crystal structure of the pvuii endonuclease with pr3+ and  ...
4k7p:L -------------------------------------------------                   Generation and characterization of a unique reagent that  ...
3h1t:A -------------------------------------------------                   The fragment structure of a putative hsdr subunit of a type  ...
2xta:A sfgltlpeilpdhftglkrisrramsapssgsskvhaveqqeildtafg                   Crystal structure of the suca domain of mycobacterium  ...
3zhr:A sfgltlpeilpdhftglkrisrramsapssgsskvhaveqqeildtafg                   Crystal structure of the h747a mutant of the suca domain of  ...
1juv:A -------------------------------------------------                   Crystal structure analysis of dihydrofolate reductase from  ...
1r6e:A*-------------------------------------------------                ×2 Solution structure of the catalytic domain of sope2
2xt6:A sfgltlpeilpdhftglkrisrramsapssgsskvhaveqqeildtafg                   Crystal structure of mycobacterium smegmatis  ...
2m7y:A -------------------------------------------------                   The mengovirus leader protein
3brj:A -------------------------------------------------                   Crystal structure of mannitol operon repressor (mtlr) from  ...
3q87:A -------------------------------------------------                   Structure of eukaryotic translation termination complex  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P23657. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 157 - - P23657 Type-2 restriction enzyme PvuII OS=Proteus hauseri GN=pvuIIR PE=1 SV=1
2. 1075 100.0% 156 156 1436.0 5.2e-73 1eyu:A * High resolution structure of the pvuii endonculease/cognate DNA complex at ph 4.6
3. " " " " " "  = 1h56:A *
Structural and biochemical characterization of a new magnesium ion binding site near tyr94 in the restriction endonuclease pvuii
4. " " " " " "  = 1pvi:A *
Structure of pvuii endonuclease with cognate DNA
5. 1066 99.4% 156 156 1424.0 2.4e-72 3pvi:A D34g mutant of pvuii endonuclease complexed with cognate DNA shows that asp34 is directly involved in DNA recognition and indirectly involved in catalysis
6. 1066 99.4% 155 157 1423.9 2.4e-72 1ni0:A Structure of the y94f mutant of the restriction endonuclease pvuii
7. 1058 98.7% 156 156 1413.3 9.5e-72 2pvi:A Pvuii endonuclease complexed to an iodinated cognate DNA
8. 1048 98.7% 156 154 1400.1 5.2e-71 1pvu:A The crystal structure of pvuii endonuclease reveals extensive structural homologies to ecorv
9. 1046 98.7% 156 154 1397.5 7.3e-71 1f0o:A Pvuii endonuclease/cognate DNA complex (glutaraldehyde- crosslinked crystal) at ph 7.5 with two calcium ions at each active site
10. 1048 98.7% 156 313 1381.6 5.5e-70 3ksk:A Crystal structure of single chain pvuii
11. 1023 98.7% 153 151 1367.0 3.6e-69 1k0z:A Crystal structure of the pvuii endonuclease with pr3+ and so4 ions bound in the active site at 2.05a.
12. 92 22.0% 91 214 126.3 4.7 4k7p:L Generation and characterization of a unique reagent that rec panel of recombinant human monoclonal antibody therapeutics presence of endogenous human igg
13. 89 25.4% 122 515 115.8 18 3h1t:A The fragment structure of a putative hsdr subunit of a type i restriction enzyme from vibrio vulnificus yj016
14. 89 26.4% 87 826 112.4 28 2xta:A Crystal structure of the suca domain of mycobacterium smegmatis alpha-ketoglutarate decarboxylase in complex with acetyl-coa (triclinic form)
15. 89 26.4% 87 822 112.4 28 3zhr:A Crystal structure of the h747a mutant of the suca domain of mycobacterium smegmatis kgd showing the active site lid clo
16. 80 21.3% 75 193 111.1 33 1juv:A Crystal structure analysis of dihydrofolate reductase from bacteriophage t4
17. 79 21.3% 75 168 110.7 34 1r6e:A * Solution structure of the catalytic domain of sope2
18. " " " " " "  = 1r9k:A *
Representative solution structure of the catalytic domain of
19. 89 26.4% 87 1055 110.6 35 2xt6:A Crystal structure of mycobacterium smegmatis alpha-ketogluta decarboxylase homodimer (orthorhombic form)
20. 74 31.4% 35 71 110.4 36 2m7y:A The mengovirus leader protein
21. 78 23.0% 113 167 109.5 40 3brj:A Crystal structure of mannitol operon repressor (mtlr) from v parahaemolyticus rimd 2210633
22. 76 29.0% 69 122 109.1 42 3q87:A Structure of eukaryotic translation termination complex methyltransferase mtq2-trm112

Number of sequences: 22

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer