Sequence alignment between 3o5h(R) and UniProt seq P0CX49 (RL18A_YEAST):

P0CX49 (RL18A_YEAST): 60S ribosomal protein L18-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL18A PE=1 SV=1
                 10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180      
         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+------
UniProt: MGIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKALFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTVAALRFTAGARAKIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVRHFGMGPHKGKAPRILSTGRKFERARGRRRSKGFKV
PDB seq: ----------------TAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKALFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTVAALRFTAGARAKIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVRHFGMGPHK---------------------------
                         ---+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------                           
                           20        30        40        50        60        70        80        90       100       110       120       130       140       150