Sequence alignment between 3o30(L) and UniProt seq P0CX56 (RS18B_YEAST):

P0CX56 (RS18B_YEAST): 40S ribosomal protein S18-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS18B PE=1 SV=1
                 10        20        30        40        50        60        70        80        90       100       110       120       130       140      
         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+------
UniProt: MSLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYHTLANNVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRRRA
         ......................................................................................XXXXXXX.....................................................
PDB seq: --------------LRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFL-------DGKDYHTLANNVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTT-----
                       -----+---------+---------+---------+---------+---------+---------+------       ------+---------+---------+---------+---------+-     
                           20        30        40        50        60        70        80                 100       110       120       130       140