Sequence alignment between 3o30(J) and UniProt seq P0CX51 (RS16A_YEAST):

P0CX51 (RS16A_YEAST): 40S ribosomal protein S16-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS16A PE=1 SV=1
                 10        20        30        40        50        60        70        80        90       100       110       120       130       140   
         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---
UniProt: MSAVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR
PDB seq: ---------FGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR
                  +---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---
                 10        20        30        40        50        60        70        80        90       100       110       120       130       140