Sequence alignment between 3o2z(F) and UniProt seq P0CX47 (RS11A_YEAST):

P0CX47 (RS11A_YEAST): 40S ribosomal protein S11-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS11A PE=1 SV=1
                 10        20        30        40        50        60        70        80        90       100       110       120       130       140       150      
         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+------
UniProt: MSTELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAGKANKQFAKF
PDB seq: --------------------------------------------------------------------KILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAA-----------
                                                                             -+---------+---------+---------+---------+---------+---------+---------+-----           
                                                                             70        80        90       100       110       120       130       140