Sequence alignment between 3izr(U) and UniProt seq Q7XYC9 (Q7XYC9_WHEAT):

Q7XYC9 (Q7XYC9_WHEAT): 60s ribosomal protein L21 (Fragment) OS=Triticum aestivum PE=2 SV=1
                 10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  
         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+--
UniProt: GXGGRKGKMPAGHGLRSRTRDLFARPFRKKGYIPLTTYLRTYKVGEHVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCNEEFLQRKLNNDKLXAEAKARGEVISTKRQPAGPKPGFMVEGTTIETVTPIPYDVVNDLXGGY
         ...........................................................................................................................X............................................X...
PDB seq: --------MPAGHGLRSRTRDLFARPFRKKGYIPLTTYLRTYKVGEHVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCNEEFLQRKLNNDKLKAEAKARGEVISTKRQPAGPKPGFMVEGTTIETVTPIPYDVVNDLKGGY
                 ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+----
                         10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160