Sequence alignment between 3it8(D) and UniProt seq Q9DHW0 (Q9DHW0_YLDV):

Q9DHW0 (Q9DHW0_YLDV): 2L protein OS=Yaba-like disease virus GN=2L PE=1 SV=1
                 10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330        
         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+--------
UniProt: MDKLLLFSTIVAVCNCITLKYNYTVTLKDDGLYDGVFYDHYNDQLVTKISYNHETRHGNVNFRADWFNISRSPHTPGNDYNFNFWYSLMKETLEEINKNDSTKTTSLSLITGCYETGLLFGSYGYVETANGPLARYHTGDKRFTKMTHKGFPKVGMLTVKNTLWKDVKAYLGGFEYMGCSLAILDYQKMAKGKIPKDTTPTVKVTGNELEDGNMTLECTVNSFYPPDVITKWIESEHFKGEYKYVNGRYYPEWGRKSNYEPGEPGFPWNIKKDKDANTYSLTDLVRTTSKMSSQPVCVVFHDTLEAQVYTCSEGCNGELYDHLYRKTEEGEGEEDEED
PDB seq: ----------------ITLKYNYTVTLKDDGLYDGVFYDHYNDQLVTKISYNHETRHGNVNFRADWFNISRSPHTPGNDYNFNFWYSLMKETLEEINKNDSTKTTSLSLITGCYETGLLFGSYGYVETANGPLARYHTGDKRFTKMTHKGFPKVGMLTVKNTLWKDVKAYLGGFEYMGCSLAILDYQKMAKGKIPKDTTPTVKVTGNELEDGNMTLECTVNSFYPPDVITKWIESEHFKGEYKYVNGRYYPEWGRKSNYEPGEPGFPWNIKKDKDANTYSLTDLVRTTSKMSSQPVCVVFHDTLEAQVYTCSEGC-----------------------
                         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------                       
                                 10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290