Sequence alignment between 2xgy(A) and UniProt seq :

UniProt: 
PDB seq: PIMEYEPVGPGLIAAWLKQVQEHGLTHPATITYFGVISINFTSVDINMLLNVTPGAEKQLVIDKIKEKAIAWDEMHPPPPADAAGPVPLTSDQIRGIGLSPEEAAGPRFADARTLYRTWVLEALQECQR
         ---+---------+---------+---------+---------+---------+-------+---------+---------+---------+---------+---------+---------+-------
           10        20        30        40        50        60      70        80        90       100       110       120       130