Sequence alignment between 2icw(J) and UniProt seq A2NTY6 (A2NTY6_MOUSE):

A2NTY6 (A2NTY6_MOUSE): Beta-chain (Fragment) OS=Mus musculus PE=1 SV=1
                 10        20        30        40        50        60        70        80        90       100       110       120       130       140       
         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+----
UniProt: MSNTAFPDPAWNTTLLSWVALFLLGTKHMEAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGELGGFNQDTQYFGPGTRLLVL---
         .............................................X........................X.....................................X..............XX..XXXX.X...X....X.....
PDB seq: -----------------------------EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILESATPSQTSVYFCASG--GG---GTLYFGAGTRLSVLSSA
                                      ---------+---------+---------+---------+---------+---------+---------+---------+---------+----  --   ---+---------+---
                                              10        20        30        40        50        60        70        80        90            100       110