Sequence alignment between 1uvq(B) and UniProt seq P01920 (DQB1_HUMAN):

P01920 (DQB1_HUMAN): HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens GN=HLA-DQB1 PE=1 SV=2
                 10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260 
         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+-
UniProt: MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH
         ........................................X...X............X..................X.......X.X..............X.............XXXX.XX..............XXXXXXXX............X..............X..........................X..............X...............................................
PDB seq: ----------------------------------SPEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPS--------NLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQ--------------------------------------
                                           -------+---------+---------+---------+---------+---------+---------+---------+---------+---------+----        -------+---------+---------+---------+---------+---------+---------+---------+-                                      
                                                 10        20        30        40        50        60        70        80        90       100                 120       130       140       150       160       170       180       190