Sequence alignment between 1rns() and UniProt seq :

UniProt: 
PDB seq: SSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+----
                 30        40        50        60        70        80        90       100       110       120