Sequence alignment between 1o1f(B) and UniProt seq P02609 (MLRS_CHICK):

P02609 (MLRS_CHICK): Myosin regulatory light chain 2, skeletal muscle isoform OS=Gallus gallus GN=MYLPF PE=1 SV=2
                 10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160        
         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+--------
UniProt: MAPKKAKRRAAEGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKDDLRETFAAMGRLNVKNEELDAMIKEASGPINFTVFLTMFGEKLKGADPEDVIMGAFKVLDPDGKGSIKKSFLEELLTTQCDRFTPEEIKNMWAAFPPDVAGNVDYKNICYVITHGEDKEGE
         ......................X.X.XX...........X.....................................................................................XXX....................................X...
PDB seq: --------------------FDETEIEDFKEAFTVIDQNADGIIDKDDLRETFAAMGRLNVKNEELDAMIKEASGPINFTVFLTMFGEKLKGADPEDVIMGAFKVLDPDGKGSIKKSFLEELLTTGGGRFTPEEIKNMWAAFPPDVAGNVDYKNICYVITHGEDA---
                             -+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---   
                             20        30        40        50        60        70        80        90       100       110       120       130       140       150       160