Sequence alignment between 1nmb(H) and UniProt seq :

UniProt: 
PDB seq: QVQLQQPGAELVKPGASVRMSCKASGYTFTNYNMYWVKQSPGQGLEWIGIFYPGNGDTSYNQKFKDKATLTADKSSNTAYMQLSSLTSEDSAVYYCARSGGSYRYDGGFDYWGQGTTLTVSS
         ---------+---------+---------+---------+---------+----------+---------+---------+------------+---------+----+---------+---
                 10        20        30        40        50         60        70        80           90       100 100E       110