Sequence alignment between 1mhb(B) and UniProt seq :

UniProt: 
PDB seq: VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDPENFRLLGNVLALVVARHFGKDFTPELQASYQKVVAGVANALAHKYH
         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+------
                 10        20        30        40        50        60        70        80        90       100       110       120       130       140