Sequence alignment between 1m8q(C) and UniProt seq P02604 (MLE1_CHICK):

P02604 (MLE1_CHICK): Myosin light chain 1, skeletal muscle isoform OS=Gallus gallus PE=1 SV=3
                 10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190  
         ---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+--
UniProt: MAPKKDVKKPAAAAAPAPAPAPAPAPAPAKPKEPAIDLKSIKIEFSKEQQDDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITFEEFLPMLQAAANNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVEELMKGQEDSNGCINYEAFVKHIMSV
         ...............................................XXX...................X......X..........................XX.......................................................................................
PDB seq: ---------------------------------------------SKAAADDFKEAFLLFDRTGDAKITASQVGDIARALGQNPTNAEINKILGNPSKEEMNAAAITFEEFLPMLQAAANNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVEELMKGQEDSNGCINYEAFVKHIMSV
                                                      -------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------
                                                            10        20        30        40        50        60        70        80        90       100       110       120       130       140