Sequence alignment between 1cac() and UniProt seq :

UniProt: 
PDB seq: HWGYGKHDGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNDGHAFNVEFDDSEDKAVLKGGPLDGTYRLIQFHFHWGSLDGEGSQHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFDGEGEPEELMVDNWRPAQPLKNRQIKASF
         ------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+--------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
              10        20        30        40        50        60        70        80        90       100       110       120      130       140       150       160       170       180       190       200       210       220       230       240       250       260