PDBe-KB: UniProt Coverage View:
P23709
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 5lc5, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/5lc5_entity_3_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>5lc5</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 5lc5, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/5lc5_entity_3_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>5lc5</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 5lc5, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/5lc5_entity_3_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>5lc5</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Top view.")
Chain: C
Length: 206 amino acids
Theoretical weight: 24.2 KDa
Source organism: Bos taurus
UniProt:
FASTA Sequence
Length: 206 amino acids
Theoretical weight: 24.2 KDa
Source organism: Bos taurus
UniProt:
- Canonical: P23709 (Residues: 46-251; Coverage: 77%)
FASTA Sequence
>pdb|5lc5|C
RPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLRDHSNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESSVPVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPP
PDBe-KB: UniProt Coverage View:
P23709