› › Inhibitor of g-type lysozyme

Inhibitor of g-type lysozyme in PDB entry 4g9s, assembly 2, front view.
Inhibitor of g-type lysozyme in PDB entry 4g9s, assembly 2, side view.
Inhibitor of g-type lysozyme in PDB entry 4g9s, assembly 2, top view.
Chain: B
Length: 111 amino acids
Theoretical weight: 12.54 KDa
Source organism: Escherichia coli
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: P76002 (Residues: 23-133; Coverage: 100%)
Gene names: JW1167, b1178, pliG, ycgK
FASTA Sequence
>pdb|4g9s|B
AGKNVNVEFRKGHSSAQYSGEIKGYDYDTYTFYAKKGQKVHVSISNEGADTYLFGPGIDDSVDLSRYSPELDSHGQYSLPASGKYELRVLQTRNDARKNKTKKYNVDIQIK
PDBe-KB: UniProt Coverage View: P76002  

Quick links

Search similar proteins