Heat shock protein beta-1

Chain: A
Length: 85 amino acids
Theoretical weight: 9.29 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: P04792 (Residues: 90-171; Coverage: 40%)
Gene names: HSP27, HSP28, HSPB1
FASTA Sequence
>pdb|3q9p|A
GGSHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHAARQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPK