Protease

Chain: A
Length: 99 amino acids
Theoretical weight: 10.82 KDa
Source organism: Human immunodeficiency virus 1
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: P35963 (Residues: 489-587; Coverage: 7%)
Gene name: gag-pol
FASTA Sequence
>pdb|3oqd|A
PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPFNVIGRNLMTQIGCTLNF