› › Cysteine and glycine-rich protein 3

Cysteine and glycine-rich protein 3 in PDB entry 2o10, assembly 1, front view.
Cysteine and glycine-rich protein 3 in PDB entry 2o10, assembly 1, side view.
Cysteine and glycine-rich protein 3 in PDB entry 2o10, assembly 1, top view.
Chain: A
Length: 60 amino acids
Theoretical weight: 6.78 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: P50461 (Residues: 7-66; Coverage: 31%)
Gene names: CLP, CSRP3, MLP
FASTA Sequence
>pdb|2o10|A
GAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRY
PDBe-KB: UniProt Coverage View: P50461  

Quick links

Search similar proteins