Cytochrome c-L

Chains: D, H, L, P
Length: 147 amino acids
Theoretical weight: 16.27 KDa
Source organism: Paracoccus denitrificans
UniProt:
  • Canonical: P29899 (Residues: 23-169; Coverage: 95%)
Gene name: moxG
FASTA Sequence
>pdb|2gc4|D H L P
APQFFNIIDGSPLNFDDAMEEGRDTEAVKHFLETGENVYNEDPEILPEAEELYAGMCSGCHGHYAEGKIGPGLNDAYWTYPGNETDVGLFSTLYGGATGQMGPMWGSLTLDEMLRTMAWVRHLYTGDPKDASWLTDEQKAGFTPFQP