Amicyanin

Chains: C, G, K, O
Length: 105 amino acids
Theoretical weight: 11.51 KDa
Source organism: Paracoccus denitrificans
UniProt:
  • Canonical: P22364 (Residues: 27-131; Coverage: 100%)
Gene names: ami, mauC
FASTA Sequence
>pdb|2gc4|C G K O
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE