Methylamine dehydrogenase light chain

Chains: B, F, J, N
Length: 131 amino acids
Theoretical weight: 14.21 KDa
Source organism: Paracoccus denitrificans
UniProt:
  • Canonical: P22619 (Residues: 58-188; Coverage: 100%)
Gene name: mauA
FASTA Sequence
>pdb|2gc4|B F J N
ADAPAGTDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASWVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS