› › POZ-, AT hook-, and zinc finger-containing protein 1

POZ-, AT hook-, and zinc finger-containing protein 1 in PDB entry 2epq, assembly 1, front view.
POZ-, AT hook-, and zinc finger-containing protein 1 in PDB entry 2epq, assembly 1, side view.
POZ-, AT hook-, and zinc finger-containing protein 1 in PDB entry 2epq, assembly 1, top view.
Chain: A
Length: 45 amino acids
Theoretical weight: 4.73 KDa
Source organism: Homo sapiens
Expression system: Not provided
UniProt:
  • Canonical: Q9HBE1 (Residues: 380-411; Coverage: 5%)
Gene names: PATZ, PATZ1, RIAZ, ZBTB19, ZNF278, ZSG
FASTA Sequence
>pdb|2epq|A
GSSGSSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKSGPSSG
PDBe-KB: UniProt Coverage View: Q9HBE1  

Quick links

Search similar proteins