Immunoglobulin heavy constant alpha 1

Chains: A, B
Length: 214 amino acids
Theoretical weight: 23.23 KDa
Source organism: Homo sapiens
Expression system: Cricetulus griseus
UniProt:
  • Canonical: P01876 (Residues: 122-335; Coverage: 61%)
Gene name: IGHA1
FASTA Sequence
>pdb|1ow0|A B
ACHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGK