IGG2A INTACT ANTIBODY - MAB231

Chains: A, C
Length: 214 amino acids
Theoretical weight: 23.42 KDa
Source organism: Mus musculus
FASTA Sequence
>pdb|1igt|A C
DIVLTQSPSSLSASLGDTITITCHASQNINVWLSWYQQKPGNIPKLLIYKASNLHTGVPSRFSGSGSGTGFTLTISSLQPEDIATYYCQQGQSYPLTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Visualisation