PDBe-KB: UniProt Coverage View:
P38540
![Methanol dehydrogenase [cytochrome c] subunit 2 in PDB entry 1g72, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/1g72_entity_2_front_image-200x200.png "Hetero tetrameric assembly 1 of PDB entry <span class='highlight'>1g72</span> contains 2 copies of <span class='highlight'>Methanol dehydrogenase [cytochrome c] subunit 2</span>. Front view.")
![Methanol dehydrogenase [cytochrome c] subunit 2 in PDB entry 1g72, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/1g72_entity_2_side_image-200x200.png "Hetero tetrameric assembly 1 of PDB entry <span class='highlight'>1g72</span> contains 2 copies of <span class='highlight'>Methanol dehydrogenase [cytochrome c] subunit 2</span>. Side view.")
![Methanol dehydrogenase [cytochrome c] subunit 2 in PDB entry 1g72, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/1g72_entity_2_top_image-200x200.png "Hetero tetrameric assembly 1 of PDB entry <span class='highlight'>1g72</span> contains 2 copies of <span class='highlight'>Methanol dehydrogenase [cytochrome c] subunit 2</span>. Top view.")
Chains: B, D
Length: 69 amino acids
Theoretical weight: 7.77 KDa
Source organism: Methylophilus methylotrophus W3A1
UniProt:
FASTA Sequence
Length: 69 amino acids
Theoretical weight: 7.77 KDa
Source organism: Methylophilus methylotrophus W3A1
UniProt:
- Canonical: P38540 (Residues: 23-91; Coverage: 100%)
FASTA Sequence
>pdb|1g72|B D
YDGQNCKEPGNCWENKPGYPEKIAGSKYDPKHDPVELNKQEESIKAMDARNAKRIANAKSSGNFVFDVK
PDBe-KB: UniProt Coverage View:
P38540