PDB 1wbn biological assemblies and structure analysis ‹ Protein Data Bank in Europe (PDBe)

Assemblies

Assembly 1 (preferred)

Download 3D Visualisation

Assembly Name: Mitogen-activated protein kinase 14
hide full assembly name

Multimeric state: monomeric

PDBe Complex ID: PDB-CPX-172487

$Monomeric assembly 1 of PDB entry 1wbn coloured by chemically distinct molecules, front view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>1 copy of Mitogen-activated protein kinase 14;</li> <li class='image_legend_li'>1 copy of N-(3-TERT-BUTYL-1H-PYRAZOL-5-YL)-N'-{4-CHLORO-3-[(PYRIDIN-3-YLOXY)METHYL]PHENYL}UREA;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

$Monomeric assembly 1 of PDB entry 1wbn coloured by chemically distinct molecules, side view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>1 copy of Mitogen-activated protein kinase 14;</li> <li class='image_legend_li'>1 copy of N-(3-TERT-BUTYL-1H-PYRAZOL-5-YL)-N'-{4-CHLORO-3-[(PYRIDIN-3-YLOXY)METHYL]PHENYL}UREA;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

$Monomeric assembly 1 of PDB entry 1wbn coloured by chemically distinct molecules, top view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>1 copy of Mitogen-activated protein kinase 14;</li> <li class='image_legend_li'>1 copy of N-(3-TERT-BUTYL-1H-PYRAZOL-5-YL)-N'-{4-CHLORO-3-[(PYRIDIN-3-YLOXY)METHYL]PHENYL}UREA;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

Macromolecules

Mitogen-activated protein kinase 14

Chain: A
Length: 360 amino acids
Theoretical weight: 41.34 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli BL21(DE3)
UniProt:

Canonical: Q16539 (Residues: 1-360; Coverage: 100%)

Gene names: CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2, SAPK2A
Pfam: Protein kinase domain
InterPro:

Mitogen-activated protein kinase 14
Protein kinase-like domain superfamily
Mitogen-activated protein (MAP) kinase p38-like
Protein kinase domain
Protein kinase, ATP binding site
Mitogen-activated protein (MAP) kinase, conserved site

CATH:

Phosphorylase Kinase; domain 1
Transferase(Phosphotransferase) domain 1

SCOP: Protein kinases, catalytic subunit

Mitogen-activated protein kinase 14 in PDB entry 1wbn, assembly 1, front view.

Mitogen-activated protein kinase 14 in PDB entry 1wbn, assembly 1, side view.

Mitogen-activated protein kinase 14 in PDB entry 1wbn, assembly 1, top view.

FASTA Sequence


    >pdb|1wbn|A

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

PDBe-KB: UniProt Coverage View: Q16539

Molecule details ›

Download

FASTA (Protein chains A)
Archive mmCIF file
Updated mmCIF file
PDB file
PDB header
PDB file (gz)
PDBML
PDBML (ATOM lines)
PDBML (no atoms)
SIFTS XML file with residue-level mappings

Search similar proteins

Similar 3D structures (PDBeFold)
Similar sequences

BLAST Q16539 (UniProt)

Protein Data Bank in Europe

fragment based p38 inhibitors

Quick links

Assemblies

Assembly 1 (preferred)

Macromolecules

Search similar proteins

Quick links

PDBe › 1wbn › Structure analysis

fragment based p38 inhibitors

Quick links

Assemblies

Assembly 1 (preferred)

Macromolecules

Search similar proteins

Quick links

1wbn › Structure analysis