triangle PDBeMotif: 5tsw  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification lymphokine    | release date: Thu, Apr 22, 1999
Title high resolution crystal structure of a human tnf-alpha mutant
Authors B.-H.OH, H.-S.CHO, J.-S.KIM, S.-S.CHA
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F sequence:
PSDKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TUMOR NECROSIS FACTOR-ALPHA)
member of: GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF7PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  ......eeeee..................eee...............eeeeeeeeeeeeee........eeeeeeee.......eeeeeeee..............eeeeeeeeeeeeee....eeeeee..............eeeeee.
sequence :  ..SDKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..9         19        29        39        49        59        69        79        89        99        109       119       129       139       149      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**       | || |    ^**|  |                                || | |                         | |          |      |       |  |       || ||               
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          | || |       |  |                                || | |                         | |          *******^       |  |       || ||               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | || |       |  |                                ^*****                         | |                         |  |       || ||               
search RasMol script viewer Motif-ligand binding stats  asxturn ..          ***| |       |  |                                 | |                           | |                         |  |       || ||               
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |       ****                                 | |                           | |                         |  |       ****|               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***       |  |                                 ***                           | |                         |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  niche ..                       ****                                                               ***                         ****        ****               

chain B : PROTEIN (TUMOR NECROSIS FACTOR-ALPHA)
member of: GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF7PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  ......eeeee..................eee...eee..eee....eeeeeeeeeeeeee........eeeeeeee......eeeeeeeee..............eeeeeeeeeeeeee....eeeeee..hhh.........eeeeee.
sequence :  ..SDKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..9         19        29        39        49        59        69        79        89        99        109       119       129       139       149      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**       | ||| |   ^**|  |        |  |                    || | |          | |      ||          | |    |      |       |  |       || ||| |  | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          | ||| |      |  |        |  |                    || | |          | |      ||          | |    *******^       |  |       || ||| |  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | ||| |      |  |        |  |                    ^*****          | |      ||          | |                   |  |       || ||| |  | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          ***** |      |  |        |  |                     | |            | |      ||          | |                   |  |       || ||| |  | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..          ***|  |      |  |        |  |                     | |            | |      ||          | |                   |  |       || ||***  | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  |  |      |  |        |  |                     | |            | |      **          | |                   |  |       || ||     | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..          *******      ****        ****                     | |            | |                  | |                   ****       ****|     | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             |  |      |  |                                 ***            ***                  ***                   |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |      |  |                                                                                           |  |        |  |     ***       
search RasMol script viewer Motif-ligand binding stats  niche ..             ****      ****                                                                                           ****        ****               

chain C : PROTEIN (TUMOR NECROSIS FACTOR-ALPHA)
member of: GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF7PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  ......eeeee..................eee...eee..eee....eeeeeeeeeeeeee.......eeeeeeeee......eeeeeeeeee.............eeeeeeeeeeeeee....eeeeee..hhh.........eeeeee.
sequence :  ..SDKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..9         19        29        39        49        59        69        79        89        99        109       119       129       139       149      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**       | ||  |   ^**|  |        |  |                    || | |                   ||                 |      |       |  |        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          | ||  |   | ||  |        |  |                    || | |                   ||                 *******^       |  |        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | ||  |   | ||  |        |  |                    ^*****                   ||                                |  |        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..          ***|  |   | ||  |        |  |                     | |                     ||                                |  |        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             |  |   | ||  |        |  |                     | |                     **                                |  |        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ****   | ||  |        ****                     | |                                                       ****        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             |  |   | ||  |                                 ***                                                       |  |        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |   | ||  |                                                                                           |  |        |  ||  | ***       
search RasMol script viewer Motif-ligand binding stats  niche ..             ****   | |****                                                                                           ****        ********           
search RasMol script viewer Motif-ligand binding stats  stturn ..                    ***                                                                                                                              

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : PROTEIN (TUMOR NECROSIS FACTOR-ALPHA)
member of: GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF7PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  ......eeeee..................eee...............eeeeeeeeeeeeee........eeeeeeee......eeeeeeeee..............eeeeeeeeeeeeee....eeeeee..............eeeeee.
sequence :  ..SDKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..9         19        29        39        49        59        69        79        89        99        109       119       129       139       149      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**       | || |    ^**|  |                                || | |          | |      ||            | |  |      |       |  |       || ||| || | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          | || |    | ||  |                                || | |          | |      ||            | |  *******^       |  |       || ||| || | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | || |    | ||  |                                ^*****          | |      ||            | |                 |  |       || ||| || | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..          ***| |    | ||  |                                 | |            | |      ||            | |                 |  |       || ||***| | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  | |    | ||  |                                 | |            | |      **            | |                 |  |       || |||  | | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  | |    | ||  |                                 | |            | |                    | |                 |  |       ****||  | | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          |  ***    | ||  |                                 ***            ***                    | |                 |  |        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |      | ||  |                                                                       | |                 |  |        |  ||  | ***       
search RasMol script viewer Motif-ligand binding stats  niche ..          ****      | |****                                                                       ***                 ****        ********           
search RasMol script viewer Motif-ligand binding stats  stturn ..                    ***                                                                                                                              

chain E : PROTEIN (TUMOR NECROSIS FACTOR-ALPHA)
member of: GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF7PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  ......eeeee..hhh.............eee...............eeeeeeeeeeeeee.......eeeeeeeee......eeeeeeeeee.............eeeeeeeeeeeeee....eeeeee..hhh.........eeeeee.
sequence :  ..SDKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..9         19        29        39        49        59        69        79        89        99        109       119       129       139       149      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**          | |    ^**|  |                                || | |          ||| |    ||    | |          |      |       |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..             | |     | |  |                                || | |          ||| |    ||    | |          *******^       |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |     | |  |                                ^*****          ||| |    ||    | |                         |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |  |                                 | |            ||| |    **    | |                         |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |  |                                 | |            ||| |          | |                         ****        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |     ***  |                                 ***            *** |          | |                         |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  nest ..             ***       |  |                                                 |  |          | |                         |  |        |  |     ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                       ****                                                 ****          ***                         ****        ****               

chain F : PROTEIN (TUMOR NECROSIS FACTOR-ALPHA)
member of: GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF7PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  ......eeeee..................eee...eee..eee....eeeeeeeeeeeeee........eeeeeeee......eeeeeeeee..............eeeeeeeeeeeeee....eeeeee..hhh.........eeeeee.
sequence :  ..SDKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..9         19        29        39        49        59        69        79        89        99        109       119       129       139       149      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**       | ||| |   ^**|  |        |  |                    || | |                           | | | | |  |      |       |  |       || ||| |            
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          | ||| |   |  |  |        |  |                    || | |                           | | | | |  *******^       |  |       || ||| |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | ||| |   |  |  |        |  |                    ^*****                           | | | | |                 |  |       || ||| |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | ||| |   |  |  |        |  |                     | |                             | | | | |                 |  |       *****| |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..          ***|| |   |  |  |        |  |                     | |                             | | | | |                 |  |       || ||***            
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ||| |   |  |  |        ****                     | |                             | | | | |                 ****       ****|               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            *** |   |  |  |                                 ***                             | | *****                 |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  niche ..             ****   *******                                                                 ***                       ****        ****               

   New search    5tsw:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors