triangle PDBeMotif: 5prc  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification photosynthetic reaction center    | release date: Fri, Aug 1, 1997
Title photosynthetic reaction center from rhodopseudomonas viridis complex)
Authors C.R.D.LANCASTER, H.MICHEL
Method X-RAY DIFFRACTION (resolution: 2.35Å)
PDBe Citation   
Small molecules:    search HEM HEM binding statistics HEM   search BCB BCB binding statistics BCB   search MQ7 MQ7 binding statistics MQ7   search FE2 FE2 binding statistics FE2   search SO4 SO4 binding statistics SO4   search NS5 NS5 binding statistics NS5   search ATZ ATZ binding statistics ATZ   search BPB BPB binding statistics BPB   search LDA LDA binding statistics LDA
Modified residues:  search FME FME binding statistics FME
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain C sequence:
CFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGPPVSQVYKNVKVLGNLTEAEFLRTMTAITEW
VSPQEGCTYCHDENNLASEAKYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTPLPPYVRYLEPTLPLNNRETP
THVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQVRVVPQTALPLVGVSRGKERRPLSDAYATFALMMSISDSL
GTNCTFCHNAQTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEAPQADCRTCHQGVTKPLFGAS
RLKDYPELGPIKAAAK
Chain L sequence:
ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPL
LEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNF
GYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNI
FLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
Chain M sequence:
ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFD
PLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGC
IHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRG
TAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHGAAPDYPAYLPATPDPASLPG
APK
Chain H sequence:
MYHGALAQHLDIAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLPHGGTVTVPR
RRPETRELKLAQTDGFEGAPLQPTGNPLVDAVGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLPVVAA
DGVEAGTVTDLWVDRSEHYFRYLELSVAGSARTALIPLGFCDVKKDKIVVTSILSEQFANVPRLQSRDQITLREEDKVSA
YYAGGLLYATPERAESLL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : PHOTOSYNTHETIC REACTION CENTER
JMol viewer RasMol script viewer  HEM 340C  ..                                                                                                                           **  ***                                                                                                         *   *                      *  *   ** **                             **  **   ***                 
JMol viewer RasMol script viewer  HEM 339C  ..                                                                                                                           ||  |||                                                                      ****                         *  ** |*  * ***  **    **        |* |** ||*||                             ||  ||   |||                 
JMol viewer RasMol script viewer  HEM 338C  ..                                                                            *           *            *   **  ** **         ||  ||* *  **   ***                                                          ||||                         |  || ||  | |||  ||    ||        || ||| |||||       *      *   *       *  ||  ||   |||                 
JMol viewer RasMol script viewer  HEM 337C  ..                                                       *******       **  *  **   *    * |**    **    | * |** || ||         ||  ||| |  ||   |||                                                          ||||                         |  || ||  | |||  ||    ||        || ||| |||||       |      |   |       |  ||  ||   |||                 
sec str:  ........eee............eeehhhhhhhhhhhhh.............................hhhhhhhhhhhhhh.....................hhhhhhhhhhhhhhhhhhh...........hhhhh................................hhhhhhhhhhh.........hhhhh.............................hhhhhhhhhhhhhhhhhh.....................hhhhhhhhhhhhhhhhhhh..hhhhh.................hhhhh.......................
sequence :  ..CFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGPPVSQVYKNVKVLGNLTEAEFLRTMTAITEWVSPQEGCTYCHDENNLASEAKYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTPLPPYVRYLEPTLPLNNRETPTHVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQVRVVPQTALPLVGVSRGKERRPLSDAYATFALMMSISDSLGTNCTFCHNAQTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEAPQADCRTCHQGVTKPLFGASRLKDYPELGPIK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321         
search RasMol script viewer Motif-ligand binding stats  PS00001 ..             | |||| |     | | |   |  |                       | ^*** | |   |      |  || |  ||  |  |  |        |   |||  |^***||  |       | || |           | | ||  || ||  |       |  ||  | | |        | ||| | |  | |   | ||||||              |  |||||^*** || ||  ||||||| |||                 |  ^***|| ||  | |         | |  || || ||| |||  |   
search RasMol script viewer Motif-ligand binding stats  PS00004 ..             | |||| |     | | |   |  |                       |  ||  | |   |      |  || |  ||  |  |  |        |   |||  |||  ||  |       | || |           | | ||  || ||  |       |  ||  | | |        | ||| | |  | |   | ||||||              |  |||||| || || ||  |||**^* |||                 |  |  ||| ||  | |         | |  || || ||| |||  |   
search RasMol script viewer Motif-ligand binding stats  PS00005 ..             | |||| |     ^** |   |  |                       |  ||  | |   |      |  || |  ||  |  |  |        |   |||  |||  ||  |       | || |           | | ||  || ||  |       |  ||  | | |        | ||| | |  | |   | ||||||              |  |||||| || || ||  ||| ||| |||                 |  |  ||| ||  | |         | |  || || ||| |||  |   
search RasMol script viewer Motif-ligand binding stats  PS00006 ..             | ||^***         |   |  |                       |  |^*** |   |      ^***| |  ||  |  |  |        |   |||  |||  ||  |       | || |           | | ||  ^***|  |       |  ||  | | |        | ||| | |  | |   | ||||||              ^***||||| || || ||  ||| ||| |||                 |  |  ||| ||  | |         | |  || || ||| |||  |   
search RasMol script viewer Motif-ligand binding stats  PS00007 ..             | |||| |         *******^                       |  |     |   |          | |  ||  |  |  |        |   |||  |||  ||  |       | || |           | | ||   |  |  |       |  ||  | | |        | ||| | |  | |   | ||||||              |  |||||| || || ||  ||| ||| |||                 |  |  ||| ||  | |         | |  || || ||| |||  |   
search RasMol script viewer Motif-ligand binding stats  PS00008 ..             | ^*****             |  |                       |  |     |   |          ^*****|  |  |  |        |   |||  |||  ||  |       | || |           | | ||   |  |  |       |  ||  | | |        | ||| | |  | |   ^*****||              |  |||^***** || ||  ||| ||| |||                 |  |  ||| ||  | |         | |  || || ||| |||  |   
search RasMol script viewer Motif-ligand binding stats  PS00009 ..             | ||||               |  |                       |  |     |   |            |  ||  |  |  |        |   |||  |||  ||  |       | || |           | | ||   |  |  |       |  ||  | | |        | ||| | |  | |   | ||| ||              |  |||||| |  || ||  |^***|| |||                 |  |  ||| ||  | |         | |  || || ||| |||  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             | ||||               |  |                       |  |     |   |            |  ||  |  |  |        |   ||**********  |       | || |           | | ||   |  |  |       *****  | | |        | ||| | |  | |   | ||| ||              |  |||||| |  || ||  | |  || |||                 |  |  ||| ||  | |         | |  || || |*****|  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..             | ||||               |  |                       |  |     |   |            |  ||  |  |  |        |   |||  | |  ||  |       | || |           | ***|   |  |  |       |  |   | | |        ***|| | |  | |   | ||| ||              |  |||||***  |***|  | |  || |||                 |  |  ||| ||  | |         | |  || || ||| | |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ****||               |  |                       |  |     |   |            |  |****  |  |        |   ||**** ********       | || |           | |  |   *******       ****   | | |        |  || | |  | |   | |****|              |  ****|  |  |   |  | |  |****|                 ****  |*****  | |         | |  ***** |**** ****   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               ||||               |  |                       |  |     |   |            |  ||  |  |  |        |   ||   |                | || |           | |  |   |  |  |              | ***        |  || | |  | |   | | |  |              |   || |  |  |   |  | |  || | |                    |  | |  |  | |         | |        | |          
search RasMol script viewer Motif-ligand binding stats  nest ..               ****               |  |                       |  |     |   |            |  ||  |  |  |        |   ||   |                ***| |           | |  |   |  |  |              | |          |  || | |  | |   *** |  |              |   |***  |  |   |  | |  || | |                    |  | |  |  ***         ***        | |          
search RasMol script viewer Motif-ligand binding stats  niche ..                                  ****                       ****     |   |            **************        |   ||   |                   ***           ******   *******              ***          *********  ***       ****              |   |     ****   **** ****| | |                    **** ****                         | |          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                      |   |                                  |   ||   |                                                               | |                                                 |   |                     *****                                                      | |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                      *****                                  **********                                                               | |                                                 *****                     | |                                                        | |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                      ***                                                                           ***                                                        ***          

chain L : PHOTOSYNTHETIC REACTION CENTER
JMol viewer RasMol script viewer  MQ7 501M  ..                            *     *   *                                                            *                                                                                                                                                                             
JMol viewer RasMol script viewer  BPB 401M  ..                            |     |   |                                                            |                                                                                *   *   *                              *                                                     
JMol viewer RasMol script viewer  BCB 806M  ..                            |     |   |                                                            |                                                        *    *                  *   |   |                              |                                                     
JMol viewer RasMol script viewer  BCB 805M  ..                            |     |   |                                                            |                                                        |    |     *     *  **  **  *   |                              *                                                     
JMol viewer RasMol script viewer  SO4 802M  ..                            |     |   |                                                            |                                                        |    |     |     |  ||  ||  |   |         *                    |                                                     
JMol viewer RasMol script viewer  FE2 500M  ..                            |     |   |                                                            |                                                        |    |     |     |  ||  ||  |   |*        |                    |         *                                           
JMol viewer RasMol script viewer  LDA 705L  ..                            *     |   |                                                            |                                                        |    |     |     |  ||  ||  |   ||        |                    |         |                                           
JMol viewer RasMol script viewer  LDA 702L  ..                            |     |   |                    * *                                     |                                                  *     |    |     |     |  ||  ||  |   ||        |                    |         |                                           
JMol viewer RasMol script viewer  ATZ 502L  ..                            |     |   |                    | |                                     |                                                  |     |    |     |     |  ||  ||  |   **        |            **  *   * *****  *|                                           
JMol viewer RasMol script viewer  BPB 402L  ..                            |     |   |         *          | |                                  *  *   *            *  ** **                       ****   |    |     |     |  ||  ||  |   ||        |            ||  |   | |||||  ||      *   *                                
JMol viewer RasMol script viewer  BCB 304L  ..                            |     |   |         *          | |                                  |  |   |            |  || ||   *                 * ||***  *    |     |     |  ||  ||  |   ||        |            ||  |   | |||||  ||      |   |                                
JMol viewer RasMol script viewer  BCB 302L  ..                            |     |   |         |          | |                                  *  |   |            |  || |*  **                 | |||| ||  *  ***    **    *****|  |   ||        |            ||  |   | |||||  ||      |  **  *   *                         
JMol viewer RasMol script viewer  HEM 339C  ..                            |     |   |         |          | |                                  |  |   |            |  || ||  ||                 | |||| ||  |  |||    ||    || ||| |||  |   ||        |            ||  |   | |||||  ||      |  ||  |   |                         
sec str:  .................................hhhhhhhhhhhhhhhhhhhhhhhh............................hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh......
sequence :  ..ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261          
search RasMol script viewer Motif-ligand binding stats  PS00005 ..  |  |       |    |  | | || |             |   |          | || ||        || |  |  || ||   |    |    |       ^**| |     |  |                | ||  |     || ||      | ||||| |  ||   |         | | ||       || |               | || |       ||   |     |  ||| ||  |     | || || ||  |
search RasMol script viewer Motif-ligand binding stats  PS00006 ..  |  |       |    |  | | || |             |   |          | || ||        || |  |  || ||   |    |    |          | |     |  |                | ||  |     |^***      | ||||| |  ||   |         | | ||       || |               | || |       ||   |     |  ||| ||  |     | || || ||  |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..  |  |       ^*****  | | || |             |   |          | || ||        || |  |  || ||   |    ^*****          | |     |  |                | ||  |     |  ||      | ||||| |  ||   |         ^*****       || |               | || |       ^*****     ^***** ||  |     | || || ||  |
search RasMol script viewer Motif-ligand binding stats  PS00244 ..  |  |               | | || |             |   |          | || ||        || |  |  || ||   |                    | |     |  |                | ||  |     |  ||      | ||*******^****************^**        || |               | || |        |   |        ||  ||  |     | || || ||  |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |               | | || |             |   |          | *****        || |  |  || ||   |                    | |     |  |                | ||  |     *****      | ||||| |   |   |                      || |               | || |        |   |        ||  ||  |     | ***** ||  |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |               | | || |             |   |          | *****        || |  |  || ||   |                    | |     |  |                | ||  |     |  |       | ||||| |   |   |                      || |               | || |        |   |        ||  ||  |     | || |  ||  |
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |               | | || |             |   |          | || ||        || |  |  || ||   |                    | |     |  |                | ||  |     |  |       | ||*** |   |   |                      || |               | || |        |   |        ||  ||  |     | || |  ||  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****               | | ****             |   |          | ****|        ****  ****| ||   |                    | |     ****                | ||  |     ****       ****||  |   |   |                      ****               | || |        |   |        ||  ||  |     ******  |****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     ***  | |             |   |          | ||  |         | |      | ||   |                    | |                         | ||  |                  ***|  |   |   |                       | |               | || |        |   |        ||  ||  |          |  |   |
search RasMol script viewer Motif-ligand binding stats  nest ..                          | |             |   |          | ||  |         | |      ***|   |                    ***                         ***|  |                     |  |   |   |                       | |               ***| |        |   |        ||  ||  |          |  |   |
search RasMol script viewer Motif-ligand binding stats  niche ..                          ***             |   |          | |****         ***         |   |                                                   ****                     ****   |   |                       ***                  | |        |   |        |********          ****   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                          *****          | |                         *****                                                                                   *****                                            | |        *****        *****                 *****
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                         ***                                                                                                                                                                  ***                                                

chain M : PHOTOSYNTHETIC REACTION CENTER
JMol viewer RasMol script viewer  LDA 701H  ..                                                                                                                                                                                                             *                                                 *         *                                                         
JMol viewer RasMol script viewer  SO4 801H  ..                                                                                                                                                                                                             |                                            *    |         |                                                         
JMol viewer RasMol script viewer  LDA 706M  ..                                                                      **  *                                    *                                                                                             |                                            |    |         |                                                         
JMol viewer RasMol script viewer  LDA 704M  ..                      *                             **  *             ||  |                                    |             *      *                                                                        |                                            |    |         |                                                         
JMol viewer RasMol script viewer  NS5 600M  ..                      |                             ||  |           * ||  |                                    |**  **  *    |      |                         **        *   * ***  *                         |                                            |    |         |                                                         
JMol viewer RasMol script viewer  MQ7 501M  ..                      |                             ||  |           | ||  |                                    |||  ||  |    |      |                         ||        |   | |||  |                         |         **  *                         *   *|    * **   *  *   *                                                     
JMol viewer RasMol script viewer  BPB 401M  ..                      |                             ||  | *  **  ** | ||  |                                    |||  ||  | ** |*     |          *  **          ||        |   | |||  |                         |         ||  |                         |   ||    | ||   |  |   |*   *                                                
JMol viewer RasMol script viewer  BCB 806M  ..                      |                             ||  | |  **|| * ||  |                                    |||  || *| |* ||     |          |  |*     **   ||        |   | |||  |   *  **     **    *  ** | *       ||  |                         |   ||    | ||   |  |   ||   *  *   *                                         
JMol viewer RasMol script viewer  BCB 805M  ..                      |                      *      ||  | |  || ||| | ||  |                                    |||  || *| || ||     |          |  ||     **  *||        |   | ||** **  *  ||     ||    |  || | |       ||  |                         |   ||    | ||   |  |   ||   |  |   |                                         
JMol viewer RasMol script viewer  SO4 804M  ..                      *                      |   *  **  | |  || ||| | ||  |                                    |||  || || || ||     *          |  ||     ||  |||        |   | |||| ||  |  ||     ||    |  || | |       ||  |                         |   ||    | ||   |  |   ||   |  |   |                                         
JMol viewer RasMol script viewer  SO4 803M  ..*                     |                      |   |  ||  | |  || ||| | ||  |                                    |||  || || || ||     |          |  ||     ||  |||        |   | |||| ||  |  ||     ||    |  || | |       ||  |     *                   |   ||    | ||   |  |   ||   |  |   |                                         
JMol viewer RasMol script viewer  SO4 802M  ..|                     |                      |   |  ||  | |  || ||| | ||  |                                    |||  || || || ||     |         *|  ||     ||  |||        |   | |||| ||  |  ||     ||    |  || | |       ||  |     |                   |   ||    | ||   | *|   ||   |  |   |                                         
JMol viewer RasMol script viewer  FE2 500M  ..|                     |                      |   |  ||  | |  || ||| | ||  |                                    |||  || || || ||     |         ||  ||     ||  |||        |   | |||| ||  |  ||     ||    |  || | |       |*  |     |     *             |   ||    | ||   |*||   ||   |  |   |                                         
JMol viewer RasMol script viewer  LDA 705L  ..|                     |                      |   |  ||  | |  || ||| | ||  |                                    |||  || || || ||     |         ||  ||     ||  |||        |   | |||| ||  |  ||     ||    |  || | |       ||  |     |     |             |   ||    * ||   ||||   ||   |  |   |                                         
JMol viewer RasMol script viewer  LDA 702L  ..|                     |                      |   |  ||  | |  || ||| | ||  |                                    |||  || || || ||     |         ||  ||     ||  |||        |   | |||| ||  |  ||     |*  * |  || | |       ||  |     |     |             |   ||    | ||   ||||   ||   |  |   |            **   **                      
JMol viewer RasMol script viewer  BPB 402L  ..|                     |                      |   |  ||  | |  || ||| | ||  |                                    |||  || || || ||     |         ||  ||     ||  |||        |   | |||| ||  |  ||     ||  | |  || | *  **   ||  |     |     |             |   *|  * | ||   ||||   ||   |  |   |            ||   ||                      
JMol viewer RasMol script viewer  BCB 304L  ..|                     |                      |   |  ||  | |  || ||| | ||  |                                    |||  || || || ||     |         ||  ||     ||  |||        |   | |||| ||  |  ||     |*  | |* |**** ||   ||  |     |     |             |   ||  | | ||   ||||   *|   |  |   |            ||   ||                      
JMol viewer RasMol script viewer  BCB 302L  ..|                     |                      |   |  ||  | |  || ||| | ||  |                                    |||  || || || ||     |         ||  ||     ||  |||        |   | |||| ||  |  ||     |*  | || |||| *| ||   ||  |     |     |             |   ||  | | ||   ||||   ||   |  |   |            ||   ||                      
JMol viewer RasMol script viewer  HEM 339C  ..|                     |                      |   |  ||  | |  || ||| | ||  |                                    |||  || || || ||     |         ||  ||     ||  |||        |   | |||| ||  |  ||*    ||  | || |||| || ||   ||  |     |     |             |   ||  | | ||   ||||   ||   |  |   |            ||   ||                      
sec str:  ......................................................hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh........................hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh...hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhh........................
sequence :  ..ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFDPLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHGAAPDYPAYLPATPDPASLPGAPK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311          
search RasMol script viewer Motif-ligand binding stats  PS00001 .. | |                   |||||      | | ||  | |           | ||| ||        |||||||| |     |  |    | |  | |      | |    |   ||     || |||  | ||||    |       |  ||       | |||||    |          | || ||  |  |          |    || ||   || ||||      | | |  |         | |^*** |  ||        |   | ||  ||| ||        ||||            |  |  |  
search RasMol script viewer Motif-ligand binding stats  PS00005 .. | |                   |||||      | | ||  | |           | ||| ||        |||||||| |     |  |    | |  | |      | |    |   ||     || |||  | ||||    |       |  ||       | |||||    |          ^**| ||  |  |          |    || ||   || ||||      ^** |  |         | |     |  ||        |   | ||  ||| ||        ||||            |  |  |  
search RasMol script viewer Motif-ligand binding stats  PS00006 .. | |                   |||||      | | ||  | |           | ||| ||        |||||||| |     |  |    | |  | |      | |    |   ||     || |||  | ||||    |       |  ||       | ^***|    |             | ||  |  |          |    || ||   || ||||          ^***         | |     |  ||        |   | ||  ||^***        ||||            |  |  |  
search RasMol script viewer Motif-ligand binding stats  PS00008 .. | |                   |||||      | | ||  | |           | ||| ||        |||||||| |     |  |    | |  | |      | |    ^*****     || |||  | |||^*****       |  ||       | ||| ^*****             | ||  |  |          ^*****| ||   || ||||                       | |     |  ||        |   | ^*****  |         ||||            |  |  |  
search RasMol script viewer Motif-ligand binding stats  PS00244 .. | |                   |||||      | | ||  | |           | ||| ||        |||||||| |     |  |    | |  | |      | |    |   |      || |||  | |||             |  ||       | ||| |                  | *******^****************^**|   || ||||                       | |     |  ||        |   | ||  ||  |         ||||            |  |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |                   |||||      | | ||  | |           ***** ||        |||||||| |     |  |    | |  | |      | |    |   |      *****|  | |||             *****       | ||| |                  | ||  |                  |   |   || ||||                       | |     *****        |   | ||  ||  |         ||||            |  |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn .. ***                   |||||      | | ||  | |           | ||  ||        |||||||***     |  |    | |  | |      | |    |   |      || | |  | |||             |  |        | ||| |                  | ||  |                  |   |   || ||||                       | |     |  |         |   | ||  ||  |         ||||            |  |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       ****|      | ****  | |           ****  ||        ******|        ****    | |  | |      | |    |   |      **** |  ****|             ****        | ||| |                  | |****                  |   |   |****||                       | |     ****         |   | ||  ||  |         ||||            ****  |  
search RasMol script viewer Motif-ligand binding stats  nest ..                       *** |      |   |   | |             ||  ||         |  ***        |  |    | |  | |      ***    |   |       |   |    ***                         ***|| |                  ***|  |                  |   |   |  ****                       ***                  |   | ||  ||  |         ****            |  |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..                        ****      |   |   ***             ||  ||         |    |        ****    ***  ***             |   |       |   |                                  |****                     ****                  |   |   |    |                                             |   | |********          ***            *******  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                  |   |                   ||  ||         ******                                     |   |       |   |                                  | |                                             |   |   ******                                             |   | |   |                                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                  *****                   ||  ||                                                    |   |       |   |                                  | |                                             |   |                                                      |   | |   |                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                          ******                                                    *****       *****                                  | |                                             *****                                                      ***** *****                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                       ***                                                                                                                                                         

chain H : PHOTOSYNTHETIC REACTION CENTER
JMol viewer RasMol script viewer  LDA 703H  ..                                         *                ** * **              *                                                                                                                                                                                  
JMol viewer RasMol script viewer  LDA 701H  ..                                *        |                || | ||              |                                                                                                                                                                                  
JMol viewer RasMol script viewer  SO4 801H  ..                                |   *   *|                || | ||              |                                                                                                                                                                                  
JMol viewer RasMol script viewer  SO4 803M  ..                                |   |   ||                || | ||              |                                                                                                                                                                     *            
JMol viewer RasMol script viewer  SO4 802M  ..                                |   |   ||                || | ||              |                                                                                                                                                                     |            
JMol viewer RasMol script viewer  LDA 705L  ..                                |   |   ||                || | ||              |                                                                                                                                                                     |            
JMol viewer RasMol script viewer  LDA 702L  ..                *               |   |   ||                || | ||              |                                                                                                                                                                     |            
sec str:  .............hhhhhhhhhhhhhhhhhhh.hhhhhh..................hhhhh.....eeee.....eeee...........eee........eee...hhhh.......................eee...................eee.....eeeeeeeeeee.......eeeeee.....eeeee...eee....eee....hhhhhh...........hhhhhhhhhhhhhhhhh..........
sequence :  ..MYHGALAQHLDIAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLPHGGTVTVPRRRPETRELKLAQTDGFEGAPLQPTGNPLVDAVGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLPVVAADGVEAGTVTDLWVDRSEHYFRYLELSVAGSARTALIPLGFCDVKKDKIVVTSILSEQFANVPRLQSRDQITLREEDKVSAYYAGGLLYATPERAESLL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251     
search RasMol script viewer Motif-ligand binding stats  PS00005 .. |  |                |   |    |  |||||| |                 |  |          |    |     | |       | |  |          | ||  | |||        | || |     |  || || | ||| |   | |||   |  |   | || |       | |^** |   |  |  |  |  |  |    |  |  | |  | ^**||      |  || ||| |  |   
search RasMol script viewer Motif-ligand binding stats  PS00006 .. |  |                |   |    |  |||||| |                 |  |          |    |     | |       | |  |          | ||  ^***|        | || |     |  |^*** | ||| |   | |||   ^***   | || |       | ||   |   |  |  |  |  |  |    |  |  | |  | ^***|      |  || ||| |  |   
search RasMol script viewer Motif-ligand binding stats  PS00008 .. |  |                |   |    |  |||||| |                 |  |          ^*****     | |       | |  |          | ||  | | |        | || |     |  |  |  | ||| |   | |^*****      | || |       | ^*****   |  |  |  |  |  |    |  |  | |  | |  ||      |  ^***** |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |                |   |    *****|||| |                 |  |                     | |       | |  |          | ||  | | |        | || |     |  |  |  | ||| |   | |||          | || |       |  |       |  |  |  |  |  |    |  |  | |  | *****      ********  |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |                |   |    |  | |||| |                 |  |                     | |       | |  |          | ||  | | |        | || |     |  |  |  | *** |   | |||          ***| |       |  |       |  |  |  |  |  |    |  |  | |  | |  ||      |  |  |   |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  |                |   |    *******|| |                 |  |                     | |       | ****          | ||  | | |        | || |     |  |  **** |****   ****|             | |       |  |       |  |  |  |  |  |    |  |  | |  | ****|      *******   |  |   
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |                |   |         | || |                 |  |                     | |       | |  |          | ||  | ***        | || |     |  |  |  | ||| |     | |             | |       |  |       |  |  |  |  |  |    |  |  | |  | |   |                |  |   
search RasMol script viewer Motif-ligand binding stats  nest .. |  |                |   |         | || |                 |  |                     | |       | |  |          ***|  |            ***| |     |  |  |  | ||| |     ***             ***       |  |       |  |  |  |  |  |    |  |  | |  | |   |                |  |   
search RasMol script viewer Motif-ligand binding stats  niche .. ****                |   |         ******                 ****                     ***       ******             ****               ***     ****  **** *****                               ****       ****  ****  ****    ****  ****** |   |                ****   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                     |   |                                                                                                                                                                                                            *****                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     *****                                                                                                                                                                                                                                        

   New search    5prc:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors