triangle PDBeMotif: 4x86  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Wed, Dec 10, 2014
Title crystal structure of bag6-ubl4a complex
Authors N.KUWABARA, R.KATO
Method X-RAY DIFFRACTION (resolution: 1.85Å)
PDBe Citation   
Small molecules:    search CPS CPS binding statistics CPS   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GPLGSVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEV
Chain B sequence:
GPLGSAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFP
N
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN 4A
JMol viewer RasMol script viewer  SO4 1203B  ..                                                   
JMol viewer RasMol script viewer  SO4 1202B  ..                                                   
JMol viewer RasMol script viewer  CPS 1201B  ..                                                 * 
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..GSVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFL
seq num:  ..93        103       113       123       133        
search RasMol script viewer Motif-ligand binding stats  PS00006 .. | |       |  |^***|           |  || |^***|        
search RasMol script viewer Motif-ligand binding stats  niche .. | |       ****|   |           |  ****|   |        
search RasMol script viewer Motif-ligand binding stats  stmotif .. | |           *****           |   |  *****        
search RasMol script viewer Motif-ligand binding stats  ststaple .. | |                           *****               
search RasMol script viewer Motif-ligand binding stats  stturn .. ***                                               

chain B : LARGE PROLINE-RICH PROTEIN BAG6
JMol viewer RasMol script viewer  SO4 1203B  ..    *                                                   
JMol viewer RasMol script viewer  SO4 1202B  ..    |      *  *    * *   *  *                           
JMol viewer RasMol script viewer  CPS 1201B  ..    |      |  |    | |   |  |             *   *         
sec str:  .......hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..EGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQE
seq num:  ..1058      1068      1078      1088      1098      1108  
search RasMol script viewer Motif-ligand binding stats  PS00004 ..   | |           | |   || | |  |  |     | |        |    
search RasMol script viewer Motif-ligand binding stats  PS00005 ..   | |           | |   || | |  |  |     ^**        |    
search RasMol script viewer Motif-ligand binding stats  PS00006 ..   | |           | |   ^*** |  |  |                |    
search RasMol script viewer Motif-ligand binding stats  PS00007 ..   | |           | |    |   |  |  |                *****
search RasMol script viewer Motif-ligand binding stats  nest ..   | |           ***    |   |  |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..   ***                  |   |  ****                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        *****                           

   New search    4x86:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors