triangle PDBeMotif: 4tsv  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification lymphokine    | release date: Wed, Oct 29, 1997
Title high resolution crystal structure of a human tnf-alpha mutan
Authors B.-H.OH, H.-S.CHO, J.-S.KIM, S.-S.CHA
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
PSDKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR NECROSIS FACTOR-ALPHA
member of: CATH:search2.60.120.40GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF23PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  .....eeeee..................eee...eee..eee....eeeeeeeeeeeeee.......eeeeeeeee......eeeeeeeeee.............eeeeeeeeeeeeee....eeeeee..hhh.........eeeeee.
sequence :  ..DKPVAHVVANPQAEGQLQWSNRRANALLANGVELRDNQLVVPIEGLFLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..10        20        30        40        50        60        70        80        90        100       110       120       130       140       150     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..**       |  |  |   ^**|  |        |  |                    |    |                   ||                 |      |       |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         |  |  |   | ||  |        |  |                    |    |                   ||                 *******^       |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |  |   | ||  |        |  |                    ^*****                   ||                                |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  betabulge ..         |  |  |   | ||  |        |  |                                             **                                |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |  |   | ||  |        ****                                                                               |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  niche ..         *******   | |****                                                                                           ****        ****               
search RasMol script viewer Motif-ligand binding stats  stturn ..                   ***                                                                                                                              

   New search    4tsv:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors