triangle PDBeMotif: 4mjq  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.7.7
Classification transferase/transferase inhibitor    | release date: Wed, Sep 4, 2013
Title e. coli sliding clamp in complex with bromfenac
Authors A.J.OAKLEY, Z.YIN
Method X-RAY DIFFRACTION (resolution: 1.73Å)
PDBe Citation   
Small molecules:    search PGE PGE binding statistics PGE   search PG4 PG4 binding statistics PG4   search CA CA binding statistics CA   search 27R 27R binding statistics 27R   search EDO EDO binding statistics EDO   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICR
GLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLF
ETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGR
FPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFN
VSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMRL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA POLYMERASE III SUBUNIT BETA
member of: GENE3D:searchG3DSA_3.10.150.10PANTHER:searchPTHR30478PFAM:searchPF00712/searchPF02767/searchPF02768PIRSF:searchPIRSF000804SMART:searchSM00480SUPERFAMILY:searchSSF55979TIGRFAMS:searchTIGR00663UniProt:searchP0A988
JMol viewer RasMol script viewer  PG4 403B  ..                   ..                                                                                                                                                                                                                                                                                     * *                                                               
JMol viewer RasMol script viewer  PGE 401B  ..                   ..                                                                                                                                                                                                                                                 *                                   | |                                                               
JMol viewer RasMol script viewer  EDO 406A  ..                   ..                                                                                 *                                                                                                                                                               |                                   | |                                                               
JMol viewer RasMol script viewer  CL 405A  ..                   ..                                                                                 *                                                                                                                                                               |                                   | |                                                               
JMol viewer RasMol script viewer  CA 404A  ..                   ..                                                                                 |                                                                                                                                                               |                                   | |                                                               
JMol viewer RasMol script viewer  CA 403A  ..                   ..                                                                                 |                                                                                                                                                               |                                   | |                                                               
JMol viewer RasMol script viewer  PGE 402A  ..                   ..                                                                                 |               ** *                                                                                                   *                                        |                                   | |                                                               
JMol viewer RasMol script viewer  27R 401A  ..                   ..                                                                                 |               || |                           * *                 *  **                                               |                 *    *                 |                                   | |                                                        *      
sec str:  ...eeeeehhhhhhhhhhhhh.....hhhh.eeeeeee..eeeeeee...eeeeeeee.......eeeeeehhhhhhhhhhh....eeeeeee..eeeeee..eeeeee..hhhhh.........eeeeehhhhhhhhhhhhhhhh.....hhhhhheeeeeeeeeeeeeee...eeeeeeeeeeeeeeeeeeeehhhhhhhhhhh.......eeeee...eeeeee..eeeeee.......hhhhhh.....eeeeeehhhhhhhhhhhhh.......eeeeeee..eeeeeee.....eeeeeee.......eeeeeehhhhhhhhhhhh..eeeeee......eeeee.....eeeee.....
sequence :  ..MKFTVEREHLLKPLQQVSG..RPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMRL
seq num:  ..1         11       ..24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     || |||  |   | ..   ||| ||            | |||||       | |                 | |||  |              ||||        |  |       ||||      | |      |  ||  | ||  |     | |||     |||||       | |                 |  || | |      |  |          | |        || ||   | |                |  || |                    | |          |  |     ^***       | |        |  |     | || ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     || |||  |   | ..   ||| ||            | |||||       | |                 | |||  |              ^**|        |  |       ||||      ^**      |  ||  | ||  |     | |||     |||||       | |                 |  || | |      |  |          ^**        || ||   | |                |  || |                    | |          |  |                | |        |  |     | || ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     || |||  |   | ..   ||| ||            ^***|||       | |                 | |||  |              || |        |  |       ^***               |  ||  | ||  |     ^***|     |||||       | |                 |  || | |      |  |                     || ||   | |                |  || |                    | |          ^***                | |        |  |     | || ||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     || |||  |   | ..****|| ||              |||||       | |                 | ^*****              || |        |  |        ||                |  ||  | ||  |       | |     |||||       | |                 |  || | |      |  |                     || ||   | |                |  || |                    | |                              | |        |  |     | || ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     ******  |   | ..    || ||              |||||       | |                 |  ||  |              || |        |  |        ||                |  ||  | ||  |       | |     |||||       | |                 |  || | |      |  |                     || ||   | |                |  || |                    | |                              | |        |  |     | || ||         
search RasMol script viewer Motif-ligand binding stats  asxturn ..     || ||   |   | ..    || ||              |||||       | |                 |  ||  |              || |        |  |        ||                |  ||  ***|  |       | |     |***|       | |                 |  || | |      |  |                     || ||   | |                |  |***                    | |                              | |        |  |     ***| ||         
search RasMol script viewer Motif-ligand binding stats  betabulge ..     || ||   |   | ..    || ||              |||||       | |                 |  ||  |              || |        |  |        **                |  ||  |  |  |       | |     |||||       | |                 |  || | |      |  |                     || ||   | |                |  |                       | |                              | |        |  |     |  | ||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..     *****   |   | ..    *****              |||||       | |                 |  |****              ****        ****                          |  ||  |  ****       | |     |||||       | |                 |  || | |      |  |                     ****|   | |                ****                       | |                              | |        |  |     |  | ||         
search RasMol script viewer Motif-ligand binding stats  nest ..             |   | ..     |  |              |****       | |                 |  ||  |               | |        |  |                          |  ||  |             | |     |****       ***                 |  |*** |      |  |                      |  |   | |                |  |                       ***                              ***        |  |     |  | ||         
search RasMol script viewer Motif-ligand binding stats  niche ..             |   | ..     ****              | |         ***                 ********               ***        ****                          ********             ***     | |                             ****  ***      ****                      ****   ***                ****                                                                   ****     *******         
search RasMol script viewer Motif-ligand binding stats  ststaple ..             ***** ..                       | |                                                                                                                          | |                                                                                                                                                                                   | |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                   ..                       ***                                                                                                                          ***                                                                                                                                                                                   ***          

chain B : DNA POLYMERASE III SUBUNIT BETA
member of: GENE3D:searchG3DSA_3.10.150.10PANTHER:searchPTHR30478PFAM:searchPF00712/searchPF02767/searchPF02768PIRSF:searchPIRSF000804SMART:searchSM00480SUPERFAMILY:searchSSF55979TIGRFAMS:searchTIGR00663UniProt:searchP0A988
JMol viewer RasMol script viewer  CL 404B  ..                     ..                                                                                                                                                        ***                                                                     *                                                                                                                * *    
JMol viewer RasMol script viewer  PG4 403B  ..                     ..                                                                         *        * *                                                                   |||                                                                     |                                                                                                                | |    
JMol viewer RasMol script viewer  CA 402B  ..                     ..                                                                         |        | |                                                                   |||                                                                     |                                                                                                                | |    
JMol viewer RasMol script viewer  PGE 401B  ..      *              ..                                                           *             |        | |                                                                   |||                                                                     |                                                                                                                | |    
JMol viewer RasMol script viewer  CL 405A  ..      |              ..                                                           |             |        | |                                                                   |||                                                                     |                                                     * *                                                        | |    
sec str:  ...eeeeehhhhhhhhhhhh.........hhhh.eeeeeee..eeeeeee...eeeeeeee.......eeeeeehhhhhhhhhhh....eeeeeee..eeeeee..eeeeee..hhhhh.........eeeeehhhhhhhhhhhhhhhh.....hhhhhheeeeeeeeeeeeeee...eeeeeeeeeeeeeeeeeeeehhhhhhhhhhh.......eeeee...eeeeee..eeeeee.......hhhhh......eeeeeehhhhhhhhhhhhh.......eeeeeee..eeeeeee.....eeeeeee.......eeeeeehhhhhhhhhhhh..eeeeee......eeeee.....eeeee.....
sequence :  ..MKFTVEREHLLKPLQQVSGPL..GRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMRL
seq num:  ..1         11         ..23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                     ..    | |  |            | |||||                           | |||  |              ||||       || ||       ||||      | |      |  ||  | |         |  |      |||||       | |                 |  || | |      |  |          | |        || ||   | |                |  || || |                 | |          |  |     ^***       | |        |  |     | || ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                     ..    | |  |            | |||||                           | |||  |              ^**|       || ||       ||||      ^**      |  ||  | |         |  |      |||||       | |                 |  || | |      |  |          ^**        || ||   | |                |  || || |                 | |          |  |     | |        | |        |  |     | || ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                     ..    | |  |            ^***|||                           | |||  |               | |       || ||       ^***               |  ||  | |         ^***      |||||       | |                 |  || | |      |  |                     || ||   | |                |  || || |                 | |          ^***     | |        | |        |  |     | || ||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                     ..***** |  |              |||||                           | ^*****               | |       || ||        ||                |  ||  | |                   |||||       | |                 |  || | |      |  |                     || ||   | |                |  || || |                 | |                   | |        | |        |  |     | || ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     ..      |  |              |||||                           |  ||  |               | |       || ||        ||                |  ||  | |                   |||||       | |                 |  || | |      |  |                     *****   | |                |  || || |                 | |                   | |        | |        |  |     | || ||         
search RasMol script viewer Motif-ligand binding stats  asxturn ..                     ..      |  |              |***|                           |  ||  |               | |       || ||        ||                |  ||  ***                   |***|       | |                 |  |*** |      |  |                     || ||   | |                |  |***| |                 | |                   ***        | |        |  |     ***| ||         
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     ..      |  |              |||||                           |  ||  |               | |       || ||        **                |  ||  |                     |||||       | |                 |  || | |      |  |                     || ||   | |                |  |   | |                 | |                              | |        |  |     |  | ||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     ..      ****              |||||                           |  |****               | |       *****                          |  ||  |                     |||||       | |                 |  || | |      |  |                     ****|   | |                ****   | |                 | |                              | |        |  |     |  | ||         
search RasMol script viewer Motif-ligand binding stats  nest ..                     ..      |  |              |****                           |  ||  |               | |        |  |                          |  ||  |                     |****       ***                 |  |*** |      |  |                      |  |   | |                |  |   ***                 ***                              ***        |  |     |  | ||         
search RasMol script viewer Motif-ligand binding stats  niche ..                     ..      ****              | |                             ********               ***        ****                          ********                     | |                             ****  ***      ****                      ****   ***                ****                                                                   ****     *******         
search RasMol script viewer Motif-ligand binding stats  stturn ..                     ..                        ***                                                                                                                          ***                                                                                                                                                                                   ***          

   New search    4mjq:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors