triangle PDBeMotif: 4m5o  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification rna binding protein/inhibitor    | release date: Thu, Aug 8, 2013
Title 3-hydroxy-6-phenyl-1,2-dihydropyridin-2-one bound to influen h1n1 endonuclease
Authors D.PATEL, E.ARNOLD, J.D.BAUMAN, K.DAS
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search X48 X48 binding statistics X48   search MN MN binding statistics MN   search SO4 SO4 binding statistics SO4   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAHHHHHHSRAWRHPQFGGHHHHHHALEVLFQGPLGSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLE
VCFMYSDFHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVT
RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEETVEE
R
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYMERASE PA
JMol viewer RasMol script viewer  X48 308A  ..                        *   * *       *   *                                         *                                                                                                                   
JMol viewer RasMol script viewer  X48 307A  ..                       **  ** |       |   |                                         ****                                                                                                                
JMol viewer RasMol script viewer  X48 306A  ..                       ||  || |       *  **  *                                      *|||                        *          **             *                                                             
JMol viewer RasMol script viewer  EDO 305A  ..                       ||  || |       *  ||  |                                      ||||                        |          ||   *         |                                                           **
JMol viewer RasMol script viewer  SO4 304A  ..                       ||  || |   * **|  ||  |                                      ||||                        |          ||   |         |                                                           ||
JMol viewer RasMol script viewer  MN 303A  ..                       ||  || |   | |||  ||  |                                      ||||                        |          ||   |         |                                                           ||
JMol viewer RasMol script viewer  MN 302A  ..                       ||  || |   | |||  ||  |                                      *|||                        *          ||   |         |                                                           ||
JMol viewer RasMol script viewer  MN 301A  ..                       ||  || |   | |||  ||  |                                      ||||                        *          *|   |         |                                                           ||
sec str:  ......hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh.eee.....eee..........ee.eee....hhhhhhhhhhhhhhhhh.........eee....eeeeeeee..hhhhhhhhhhhhhh....eeeeee....eee.hhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh.
sequence :  ..GPLGSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSE
seq num:  ..-4        6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    |  |  |  || |         | |||| |||| |     |  | | | || |    | |   | | | | ||     ||| || |   |    | ^***||  |   || |||| |      | ||           ||||||     | | || || |||||||  |        | |   | |||||| | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  |  |  || |         | |||| |||^**     |  | | | || |    | |   | | | | ||     ||| || |   |    |   | ||  |   || |||| |      ^**|           ||^**|     | | || || |||||||  |        ^**   | |||||^** ^*
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^***  |  || |         | |||| |||        ^*** | | || |    | |   | | | | ||     ||| || |   |    |   ^***  |   || |||| |      ^***           ||||||     | ^*** |^***|^***  |              | |^***      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          |  || |         | |||| |||             | | || |    | |   | | | | ||     ||| || |   |    |   | |   ********^|| |      | |            ||||||     | | |  |  ||||||   |              | ||||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          |  || |         | |||*****             | | || |    | |   | | | | ||     ||| || |   |    |   | |       || | || |      | |            ||||||     | | |  |  |||||*****              | ||||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |***         | |||***|              | | || |    | |   | | | ***|     ||| |***   |    |   | |       || ***| |      | |            ||||||     | | |  |  |***|                   | ||||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  |            | ||||  |              | | || |    | |   | | | |  |     ||| |  |   |    |   | |       **    | |      | |            ||||||     | | |  |  | | |                   | ||||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |            ****|****              | | || |    | |   | | | |  |     ||| |  |   |    |   | |             | |      | |            ||||||     | | |  **** | |                   ****||       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          |  |              | |                  | | || |    | |   | | | |  |     ||| |  |   |    |   | |             | |      | |            ||||||     | | |       ***                     ||||       
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |              ***                  | | || |    ***   | | | |  |     ||| |  |   |    |   ***             ***      | |            ******     | ***                               ****       
search RasMol script viewer Motif-ligand binding stats  niche ..          ****                                   | ******          ***** ****     *****  |   |    |   | |                      | |               ***     | |                                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                 *****                                   *****    ***** |                      | |                       | |                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                      ***                      ***                       ***                                            

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYMERASE PA
JMol viewer RasMol script viewer  X48 308A  ..                        *   * *       *   *                                         *                                                                                                                   
JMol viewer RasMol script viewer  X48 307A  ..                       **  ** |       |   |                                         ****                                                                                                                
JMol viewer RasMol script viewer  X48 306A  ..                       ||  || |       *  **  *                                      *|||                        *          **             *                                                             
JMol viewer RasMol script viewer  EDO 305A  ..                       ||  || |       *  ||  |                                      ||||                        |          ||   *         |                                                           **
JMol viewer RasMol script viewer  SO4 304A  ..                       ||  || |   * **|  ||  |                                      ||||                        |          ||   |         |                                                           ||
JMol viewer RasMol script viewer  MN 303A  ..                       ||  || |   | |||  ||  |                                      ||||                        |          ||   |         |                                                           ||
JMol viewer RasMol script viewer  MN 302A  ..                       ||  || |   | |||  ||  |                                      *|||                        *          ||   |         |                                                           ||
JMol viewer RasMol script viewer  MN 301A  ..                       ||  || |   | |||  ||  |                                      ||||                        *          *|   |         |                                                           ||
sec str:  ......hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh.eee.....eee..........ee.eee....hhhhhhhhhhhhhhhhh.........eee....eeeeeeee..hhhhhhhhhhhhhh....eeeeee....eee.hhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh.
sequence :  ..GPLGSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSE
seq num:  ..-4        6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    |  |  |  || |         | |||| |||| |     |  | | | || |    | |   | | | | ||     ||| || |   |    | ^***||  |   || |||| |      | ||           ||||||     | | || || |||||||  |        | |   | |||||| | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  |  |  || |         | |||| |||^**     |  | | | || |    | |   | | | | ||     ||| || |   |    |   | ||  |   || |||| |      ^**|           ||^**|     | | || || |||||||  |        ^**   | |||||^** ^*
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^***  |  || |         | |||| |||        ^*** | | || |    | |   | | | | ||     ||| || |   |    |   ^***  |   || |||| |      ^***           ||||||     | ^*** |^***|^***  |              | |^***      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          |  || |         | |||| |||             | | || |    | |   | | | | ||     ||| || |   |    |   | |   ********^|| |      | |            ||||||     | | |  |  ||||||   |              | ||||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          |  || |         | |||*****             | | || |    | |   | | | | ||     ||| || |   |    |   | |       || | || |      | |            ||||||     | | |  |  |||||*****              | ||||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |***         | |||***|              | | || |    | |   | | | ***|     ||| |***   |    |   | |       || ***| |      | |            ||||||     | | |  |  |***|                   | ||||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  |            | ||||  |              | | || |    | |   | | | |  |     ||| |  |   |    |   | |       **    | |      | |            ||||||     | | |  |  | | |                   | ||||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |            ****|****              | | || |    | |   | | | |  |     ||| |  |   |    |   | |             | |      | |            ||||||     | | |  **** | |                   ****||       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          |  |              | |                  | | || |    | |   | | | |  |     ||| |  |   |    |   | |             | |      | |            ||||||     | | |       ***                     ||||       
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |              ***                  | | || |    ***   | | | |  |     ||| |  |   |    |   ***             ***      | |            ******     | ***                               ****       
search RasMol script viewer Motif-ligand binding stats  niche ..          ****                                   | ******          ***** ****     *****  |   |    |   | |                      | |               ***     | |                                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                 *****                                   *****    ***** |                      | |                       | |                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                      ***                      ***                       ***                                            

   New search    4m5o:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors