triangle PDBeMotif: 4lp0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   5.99.1.
Classification isomerase/isomerase inhibitor    | release date: Sun, Jul 14, 2013
Title crystal structure of a topoisomerase atp inhibitor
Authors A.E.EAK, B.A.SHERER, B.DANGE, G.S.BASARAB, J.I.MANCHESTER, M.URIA-NICKELSEN, P.A.BORIACK-SJODIN, R.ILLINGSWORTH, S.BIST, S.SRIRAM
Method X-RAY DIFFRACTION (resolution: 1.95Å)
PDBe Citation   
Small molecules:    search 1YM 1YM binding statistics 1YM
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MSKKEININNYNDDAIQVLEGLDAVRKRPGMYIGSTDGAGLHHLVWEIVDNAVDEALSGFGDRIDVTINKDGSLTVQDHG
RGMPTGMHAMGIPTVEVIFTILHAGGKFGQGGYKTSGGLHGVGSSVVNALSSWLEVEITRDGAVYKQRFENGGKPVTTLK
KIGTALKSKTGTKVTFMPDATIFSTTDFKYNTISERLNESAFLLKNVTLSLTDKRTDEAIEFHYEN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TOPOISOMERASE IV SUBUNIT B
member of: GENE3D:searchG3DSA_3.30.230.10/searchG3DSA_3.30.565.10HAMAP:searchMF_00939PANTHER:searchPTHR10169/searchPTHR10169_SF37PFAM:searchPF02518PRINTS:searchDNAGYRASEB/searchTPI2FAMILYSMART:searchSM00387/searchSM00433SUPERFAMILY:searchSSF55874TIGRFAMS:searchTIGR01058UniProt:searchQ8DQB5
JMol viewer RasMol script viewer  1YM 301A  ..                                  *   *                    * *  ****             *     ..                                                  *                                                      
sec str:  .......hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh....eeeeee.....eeeee..............hhhhhhhhh.....hhhhhhhheeeeeeeeee..eeeeeeee...ee....eeeee......eeeeeeee..........hhhhhhhhhhhhhhhhh..eeeeee.....eeee....
sequence :  ..QVLEGLDAVRKRPGMYIGSTDGAGLHHLVWEIVDNAVDEALSGFGDRIDVTINKDGSLTVQDHGRGMPTGMHAMGIPTVEVIFTILH..VGSSVVNALSSWLEVEITRDGAVYKQRFENGGKPVTTLKKIGTALKSKTGTKVTFMPDATIFSTTDFKYNTISERLNESAFLLKNVTLSLTDKRTDEAIEFHYEN
seq num:  ..17        27        37        47        57        67        77        87        97     ..122       132       142       152       162       172       182       192       202       212       222  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..            || || |       |   |      ||| |||          | | |  |   |    | |  |   | | ||  ..|    ||  ||  |                      | |     |  | |    |  ||||||| |    | ||| ^***    ^***| ||||| |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            || || |       |   |      ||| |||          | | |  |   |    | |  |   | | ||  ..|    ||  ||  |                      ^**     |  | |    |  ||||||| |    | ^**   |         | ^**|| |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            || || |       |   |      ||| |||          | | ^***   |    | |  |   | | ||  ..|    ||  |^***                              |  | |    |  |||||^***    ^***|   |         ^*** || |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            |^*****       |   |      ||| |||          | |        ^***** |  |   | | ||  ..*    ||  |                                  |  | ^*****  ||||| | |        |   |            | || |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            *****         |   |      ||| |||          | |               |  |   | | ||  ..     ||  |                                  |  |         ***** | |        |   |            | || |        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..            |  |          |   |      ||| |||          | |               |  |   | | ||  ..     ||  |                                  |  |         ***** | |        |   |            | || |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |  |          |   |      ||| |||          | |               |  |   | | ||  ..     ||  |                                  |  |         ***|| | |        |   |            ***| |        
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            |  |          |   |      ||| |||          | |               |  |   | | ||  ..     ||  |                                  |  |         || || | |        |   |            ******        
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ****          |   |      ||****|          | |               ****   | | ||  ..     ||  |                                  ****         ****| | |        |   |               | |        
search RasMol script viewer Motif-ligand binding stats  nest ..                          |   |      ||  ***          ***                      | | ||  ..     ||  |                                  |  |          |  | | |        |   |               ***        
search RasMol script viewer Motif-ligand binding stats  niche ..                          |   |      ||  | |                                   | ****  ..     |****                                  ****          **** ***        |   |               | |        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                          |   |      |******                                   |   |   ..     |   |                                                     | |        |   |               | |        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                          |   |      *****                                     *****   ..     *****                                                     | |        *****               | |        
search RasMol script viewer Motif-ligand binding stats  stturn ..                          |   |                                                        ..                                                               ***                            ***        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                          *   *                                                        ..                                                                                                         

   New search    4lp0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors