triangle PDBeMotif: 4l5b  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.74
Classification transferase/transferase inhibitor    | release date: Mon, Jun 10, 2013
Title human dck c4s-s74e mutant in complex with udp and the di-43
Authors A.LAVIE, J.NOMME
Method X-RAY DIFFRACTION (resolution: 1.94Å)
PDBe Citation   
Small molecules:    search UDP UDP binding statistics UDP   search 1UX 1UX binding statistics 1UX
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MGSSHHHHHHSSGLVPRGSHMATPPKRSSPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSN
VQSTQDEFEELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASN
LYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRT
LKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DEOXYCYTIDINE KINASE
member of: GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR10513/searchPTHR10513_SF19PFAM:searchPF01712PIRSF:searchPIRSF000705SUPERFAMILY:searchSSF52540UniProt:searchP27707
JMol viewer RasMol script viewer  UDP 302A  ..           ******                        ..                                                                                                                     *   *                                                ***                 
JMol viewer RasMol script viewer  1UX 301A  ..          *||||||                * *     ..           *   *  *      **                              *    *   *   *  * *                                         |   |           *                                    |||                 
sec str:  ....eeeeee.....hhhhhhhhhh.....eeee.hhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.......hhhhh...eeeee........hhhhhhhhhhhhhh.
sequence :  ..RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSN..LTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
seq num:  ..20        30        40        50         ..71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | ||  || |||||      |  | ||      ||  | ..                                         |  || ||         |  |||      || ||||^*** |             || ||         |   |      | |  |  |                 ||||||  | |  |     | |  |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  **^*  || |||||      |  | ||      ||  | ..                                         |  || ||         |  |||      || |||| |   |             || ||         |   |      | |  |  |                 ||||||  | |  |     | |  |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        || |||||      |  | ||      ||  | ..                                         |  || ||         |  ^**      || |||| |   |             || ||         |   |      | |  |  |                 ||^**|  | |  |     | |  |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        || |||||      |  | ||      ||  | ..                                         |  || ||         |   |       || ||^***   |             || ||         |   |      | |  |  |                 |||| ^*** |  |     | |  |  |  ^***         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ^*****||      |  | ||      ||  | ..                                         |  || ||         |   |       || |||| |   |             || ||         |   |      | |  |  |                 ||||      |  |     | |  |  |               
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..        ********      |  | ||      ||  | ..                                         |  || ||         |   |       || |||| |   |             || ||         |   |      | |  |  |                 ||||      |  |     | |  |  |               
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | |||||      |  | ||      ||  | ..                                         |  || ||         |   |       || |||| |   |             || ||         |   |      | |  |  |                 ||||      |  |     ***  |  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****|||      |  | ||      |**** ..                                         |  || ||         |   |       |****|| |   |             ****|         |   |      | ****  |                 ||||      |  |          ****               
search RasMol script viewer Motif-ligand binding stats  nest ..           *****      |  | ||      |   | ..                                         |  |***|         |   |       |  **** |   |              |  |         |   |      ***  |  |                 ****      |  |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                      *******      |   | ..                                         ********         |   |       |    |  |   |              ****         |   |           ****                  ***      ****                             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                         | |       |   | ..                                                          |   |       ******  |   |                           |   |                                                                           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                         | |       |   | ..                                                          *****               |   |                           *****                                                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         | |       ***** ..                                                                              *****                                                                                                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                         ***             ..                                                                                                                                                                                              

chain B : DEOXYCYTIDINE KINASE
member of: GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR10513/searchPTHR10513_SF19PFAM:searchPF01712PIRSF:searchPIRSF000705SUPERFAMILY:searchSSF52540UniProt:searchP27707
JMol viewer RasMol script viewer  UDP 302B  ..           ******                       ..                                                                                                                     *  **                                                ***                 
JMol viewer RasMol script viewer  1UX 301B  ..           ||||||                * *    ..           *  **  *       *                              *    *   *      * *                                         |  ||           *                                    |||                 
sec str:  ....eeeeeee....hhhhhhhhhhh....eeee.hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh..........eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhh.eeeee........hhhhhhhhhhhhhhh
sequence :  ..RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWS..LTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
seq num:  ..20        30        40        50        ..71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | ||  |  |||||      |  | |||     |   |..                  |   ||   |                 | |          |  |||       | ||||^*** |        |  || |  |                    | |  |  |         |   |   |||||| |||| ||      | |       |  |         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  **^*  |  |||||      |  | |||     |   |..                  |   ||   |                 | |          |  |||       | |||| |   |        |  || |  |                    | |  |  |         |   |   |||||| |||| ||      | |       |  |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        |  |||||      |  | |||     |   |..                  |   ||   |                 | |          |  ^**       | |||| |   |        |  || |  |                    | |  |  |         |   |   ||^**| |||| ||      | |       |  |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  |||||      |  | |||     |   |..                  |   ||   |                 | |          |   |        | ||^***   |        |  || |  |                    | |  |  |         |   |   |||| ^***|| ||      | |       ^***         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ^*****||      |  | |||     |   |..                  |   ||   |                 | |          |   |        | |||| |   |        |  || |  |                    | |  |  |         |   |   |||| | | || ||      | |                    
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..        ********      |  | |||     |   |..                  |   ||   |                 | |          |   |        | |||| |   |        |  || |  |                    | |  |  |         |   |   |||| | | || ||      | |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |||||      |  ****|     |   |..                  |   ||   |                 | |          |   |        ****|| |   |        ****| |  |                    | |  ****         |   |   |||| | | ****|      | |                    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           |||||      |  | |||     |   |..                  |   ||   |                 | |          |   |          |||| |   |            ***  |                    | |  |  |         |   |   |||| | |  |  |      | |                    
search RasMol script viewer Motif-ligand binding stats  nest ..           *****      |  | |||     |   |..                  |   ||   |                 ***          |   |          **** |   |              |  |                    ***  |  |         |   |   **** | |  |  |      | |                    
search RasMol script viewer Motif-ligand binding stats  niche ..                      *******|     |   |..                  |   ||   |                              |   |               |   |              ****                         ****         |   |        ***  ****      ***                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                         *****     |   |..                  |   ||   |                              *****               |   |                                                        |   |                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         | |       *****..                  **********                                                  *****                                                        *****                                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                         ***            ..                                                                                                                                                                                              

   New search    4l5b:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors