triangle PDBeMotif: 4klv  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transferase    | release date: Tue, May 7, 2013
Title crystal structure of a gnat superfamily acetyltransferase pa complex with 4-methylumbelliferyl phosphate
Authors A.JOACHIMIAK, K.A.MAJOREK, M.CHRUSZCZ, MIDWEST CENTER F, STRUCTURAL GENOMICS (MCSG), W.MINOR
Method X-RAY DIFFRACTION (resolution: 1.30Å)
PDBe Citation   
Small molecules:    search KLV KLV binding statistics KLV   search SO4 SO4 binding statistics SO4   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GHMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCAL
GNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPL
EP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UNCHARACTERIZED PROTEIN
member of: GENE3D:searchG3DSA_3.40.630.30PANTHER:searchPTHR23091/searchPTHR23091_SF150PFAM:searchPF00583PROSITE PROFILES:searchPS51186, SUPERFAMILY:searchSSF55729UniProt:searchQ9HV14
JMol viewer RasMol script viewer  EDO 219A  ..                                                        *  *                          *                                                                        
JMol viewer RasMol script viewer  EDO 218A  ..                        *                               |  |                          |*                                                                       
JMol viewer RasMol script viewer  EDO 217A  ..                        |                               |  |                          ||                                             * *                       
JMol viewer RasMol script viewer  KLV 216A  ..                        |  ** *                 *       |  |       *          **      ||                           *                 | |    *         *        
JMol viewer RasMol script viewer  EDO 215A  ..                        |  || |                 |       |  |       |         ****     ||                           *                 | |    |         |        
JMol viewer RasMol script viewer  EDO 214A  ..                        |  || |                 |       |  |       |***      ||||     ||                           |                 | |    |         |        
JMol viewer RasMol script viewer  EDO 213A  ..   ***                  |  || |                 |       |  |       ||||      ||||     ||                           |                 | |    |         |        
JMol viewer RasMol script viewer  SO4 212A  ..   |||                  |  || |                 |       |  |       ||||      ||||     ||                           |                 | |  * *         | *      
JMol viewer RasMol script viewer  SO4 211A  ..   |||                  |  || |                 |**     |  |       ||||      ||||     ||                           |                 | |  | |         | |      
JMol viewer RasMol script viewer  EDO 210A  ..   |||  **              |  || |                 |||     |  |       ||||      ||||     ||                           |                 | |  | |         | |      
JMol viewer RasMol script viewer  EDO 209A  ..   |||  ||             **|| |                 |||     |  |       ||||      ||||     ||                           |                 | |  | | *       | |      
JMol viewer RasMol script viewer  EDO 208A  ..   |||  ||   *  **     || ||| |     *           |||     |  |       ||||      ||||     ||                           |                 | |  | | |       | |      
JMol viewer RasMol script viewer  EDO 207A  ..   |||  ||   |  ||     |* ||* |     |           |||     |  |       ||||      ||||**   |*                           |                 | |  | | |       | |      
JMol viewer RasMol script viewer  EDO 206A  ..   |||  ||   |  ||     || ||| |     |           |||     |  |       ||||      ||||||   ||                         * *                 | |  | | |       | **     
JMol viewer RasMol script viewer  SO4 205A  ..   |||  ||   |  ||     || ||| |     |*          |||     |  |       ||||      ||||||   ||                         | |                 | |  | | |       | ||     
JMol viewer RasMol script viewer  SO4 204A  ..   ||| ***  *|  ||     || ||| |     ||          |||     |  |       ||||      ||||||   ||                         | |                 | |  | | |       | ||     
JMol viewer RasMol script viewer  SO4 203A  ..   ||| |||  ||  ||     || ||| |     ||          |*|     |  |       ||*|      ||||||   ||                         | |                 | |  | | |       | ||     
JMol viewer RasMol script viewer  SO4 202A  ..   ||| |||  ||  ||     || ||| |     ||          |||     |  |       ||||      ||||||   ||******                   | |          *      | |  | | |       | ||     
JMol viewer RasMol script viewer  SO4 201A  ..   ||| |||  ||  ||     || ||| |     ||          |||     |  |       ||||      ||||||   ||||||||                   | |          |      | |  | **|       | ||     
sec str:  ....eeeee.hhhhhhhhhh...hhhhhhhhh.......hhhhhhhhhhhheeeeeeee..eeeeeeeeeeee...eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhh..eeeeeeeee.....eeeeeeeeee..
sequence :  ..MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | |  |  |   || || |   |   |  |               **^*   || ||   |     || ||| | | |  || ||||||||   |    |    | |                 || |||           | ||           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^**  |  |   || || |   |   |  |               | ||   || ||   |     || ||| | | |  || ||||||||   |    |    | |                 || |||           | ||           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        |  |   || || |   |   |  |               | ^*****| ^*****     || ||| | | |  || ||^*****   ^*****    | |                 || |||           | ||           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..        |  |   || || |   |   |  |               |  |    |  |         || ||| | | |  || |||||||              | |                 || |||           ^***           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        |  |   || || *****   |  |               |  |    |  |         || ||| | | |  || |||||||              | |                 || |||           | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****   ****|         |  |               |  |    ****         |****| | | |  ****||||||              | |                 |****|           | |            
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |         |  |               |  |                 |  *** | | |   |  |*****              ***                 |  ***           ***            
search RasMol script viewer Motif-ligand binding stats  niche ..                ****         ****               ****                 |    | | | |   ****                                       |                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                     *    * * * *                                              *                               

   New search    4klv:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML